DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and AT5G06110

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001190234.1 Gene:AT5G06110 AraportID:AT5G06110 Length:663 Species:Arabidopsis thaliana

Alignment Length:594 Identity:117/595 (20%)
Similarity:213/595 (36%) Gaps:203/595 (34%)


  Fly    36 EVNRNFYEFMGINQ---TATGAEVKRAFRTLSIVLHPDK-------NPAEDA--------NIQFR 82
            ::..:.|..:|:..   .||..::::::|..::..||||       ...|:|        ...|:
plant    96 KLQHDHYALLGLGNLRYLATDDQIRKSYRDAALKHHPDKLATLLLLEETEEAKQAKKDEIESHFK 160

  Fly    83 NLVSIYEVLKDPSRREKYDRV----------------LKEGMPNWK-SALYYYRRMRKIG----- 125
            .:...||||.|.::|..:|..                .|...|.:| :|.:....:..:|     
plant   161 LIQEAYEVLMDSTKRRIFDSTDEFDDKVPTDCAPQDFFKVFGPAFKRNARWSNSPLPDLGDENTP 225

  Fly   126 LYEGAFILFLITTVGQYLFAWAAYL-------EKKYTAEQVFGTKLKK-LQKKNKNIDMDVILSE 182
            |.|          |.::...|..:.       |:::..||....:.|: ::::|..........|
plant   226 LKE----------VDRFYSTWYTFKSWREFPEEEEHDIEQAESREEKRWMERENARKTQKARKEE 280

  Fly   183 IPMPSLLNTLPIQIPLALWNLPRTIKNGF------------SKANEL--KELALEKRRQELEAV- 232
            .   :.:.||              :.|.:            .||.:|  ||..:..:||:.||. 
plant   281 Y---ARIRTL--------------VDNAYKKDIRIQKRKDDEKAKKLQKKEAKVMAKRQQEEAAA 328

  Fly   233 -------RRQEELEREAEEQARLRKEHKENLRK--RKQNSK-----AP-----------EKTEEE 272
                   ||:||..:.|.|.|:|.|..||..:|  ||:.|:     ||           |..|:.
plant   329 AAIEEEKRRKEEEAKRAAEAAQLHKRAKEREKKLLRKERSRLRVLSAPVLSQRLLGISDEHVEDL 393

  Fly   273 LRGYSQIQTREL---------------------TDDDAVRPASQKSTV---------------SG 301
            ....:..|.|:|                     .|||.:....::..|               :.
plant   394 CMSLNTEQLRKLCDKMENKEGMALAKVIKNGSNIDDDKIEIEEEEVQVAVKQNGHIEANGHVEAN 458

  Fly   302 GF----------------WTDEDLTELIRLVKKYPGGAGSRWNTIAE--SMNRSVQEV------- 341
            |.                |:.|::..|.:...|:|.|...||..|:|  ...|||:|:       
plant   459 GHVEAKVDTATHEKKEKPWSKEEIDMLRKGTTKFPKGTSQRWEVISEYIGTGRSVEEILKATKTV 523

  Fly   342 ------------TFMAAKMKENGYRIPGQT-DSVAEALV----------QESQQAQRKEKVKKAA 383
                        :|:..:........|..| :.:.|.::          .:::.|::..|.|:..
plant   524 LLQKPDSAKAFDSFLENRKPAASINSPLSTREELGEPIIPTKAHEDNNSTKTETAEQNGKTKENN 588

  Fly   384 ANAGAS--AEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKY 446
            .:.|.|  |..|...|: .|:..|:|||..|:..:.|.. ..||:::|.:||.||..:|..::..
plant   589 NSNGNSEPAAASGSDPD-GWSAVQERALVQALKTFPKET-NQRWERVATAVPGKTMNQCKKKFAD 651

  Fly   447 LCELVKTQK 455
            |.::::|:|
plant   652 LKDVIRTKK 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 18/79 (23%)
SANT 301..>341 CDD:197842 15/58 (26%)
SANT 304..341 CDD:238096 14/39 (36%)
SANT 399..447 CDD:197842 15/48 (31%)
SANT 400..447 CDD:238096 15/47 (32%)
AT5G06110NP_001190234.1 ZUO1 98..422 CDD:227594 68/351 (19%)
DnaJ 100..179 CDD:278647 18/79 (23%)
SANT 476..516 CDD:238096 14/40 (35%)
SANT 607..653 CDD:238096 16/47 (34%)
SANT 607..653 CDD:197842 16/47 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
10.910

Return to query results.
Submit another query.