DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnajc1

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001071003.1 Gene:dnajc1 ZFINID:ZDB-GENE-061103-529 Length:526 Species:Danio rerio

Alignment Length:541 Identity:175/542 (32%)
Similarity:272/542 (50%) Gaps:120/542 (22%)


  Fly    10 AGLLLLCATGASAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPA 74
            :|||::..|...||.: :||:||||||:.:.||||:.:||.|:.:|:::|:|.||::||||||..
Zfish    13 SGLLVIQPTPTLAWDA-DLELFDLVEEIPQTFYEFLSVNQDASSSEIRKAYRKLSLILHPDKNKD 76

  Fly    75 EDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTV 139
            |:|..|||.||:|||||||..||::||.:|..|:|:|:..::||||:||:...|..|:||||.||
Zfish    77 ENAENQFRQLVAIYEVLKDEERRQRYDDILVNGLPDWRQPVFYYRRVRKMSNGELGFLLFLILTV 141

  Fly   140 GQYLFAWAAYLEKKYTAEQVFGTKLKKLQKK--------------NKNIDMDVILSEIPMPSLLN 190
            |.|...|:.||||:  .:::...|.::.:||              :||...|       .|...:
Zfish   142 GHYAVIWSIYLEKQ--LDELLSRKKREKKKKQTSKMTDEMKPLAQDKNERSD-------RPHWHD 197

  Fly   191 TLPIQIPLALW------NLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLR 249
            .||::  |::|      :||..|::......:.||:.: |.::|.||:..||          ..:
Zfish   198 ILPLK--LSIWLYYSIKSLPHIIQDVKQYYKDYKEMKV-KEKEEAEALAEQE----------MQQ 249

  Fly   250 KEHKENLRKRKQNSKA--PEKTEEELRGYSQ-IQTRELTD--DDAVRPASQ--KSTVSGGFWTDE 307
            ||.:..::|.|.....  |.........|.| ....|:.|  ||.:....|  |.|..   ||::
Zfish   250 KEKRPKVKKTKVEFPVYEPSANAAFALAYDQGTSIEEIEDQMDDWLEDKKQLKKKTQE---WTED 311

  Fly   308 DLTELIRLVKKYPGGAGSRWNTIAESMNRSVQEVTFMAAKMKE--------------NGYRIPGQ 358
            |.::|.|.:.|:|||...||..||..:.|||.|||....::|:              .|..:.|:
Zfish   312 DHSQLSRCMAKFPGGTPGRWEKIAHELGRSVSEVTAKVKQIKDCVTNTSGLVKFSELKGGAVIGK 376

  Fly   359 TD---SVAEALV-----------------QESQQAQRKEKVKKAAANAGASAEKSML-------- 395
            :.   :|.::|:                 ::|:....:.:.||:|:.:..:||:.|.        
Zfish   377 SSRAITVPDSLMTQREEPVEQPLEDSGEPEDSESKALRRRAKKSASGSTGAAEERMKGRRQRDFD 441

  Fly   396 ----------------------IPETNWTQEQQRALEAAIVKY-RKTAGGDRWQKIANSVPEKTK 437
                                  ..|..|||.|||.||.|:.:| |.|.  :||.|||..||.|||
Zfish   442 PTAVDEDSEDEKKPSAPKEKAGAAEDVWTQNQQRLLELALQQYPRGTT--ERWDKIAKVVPGKTK 504

  Fly   438 EECLVRYKYLCELVKTQKRAE 458
            |||:.|:|.|.||::.:|:|:
Zfish   505 EECMCRFKLLAELIQKRKQAK 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 35/61 (57%)
SANT 301..>341 CDD:197842 17/40 (43%)
SANT 304..341 CDD:238096 17/37 (46%)
SANT 399..447 CDD:197842 27/49 (55%)
SANT 400..447 CDD:238096 27/48 (56%)
dnajc1NP_001071003.1 DnaJ 42..103 CDD:278647 35/61 (57%)
SANT 307..353 CDD:238096 19/49 (39%)
SANT 469..514 CDD:238096 27/47 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355746349
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D412930at33208
OrthoFinder 1 1.000 FOG0004035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_133220
Panther 1 1.100 LDO PTHR44653
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.