DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnajc1

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001011351.1 Gene:dnajc1 XenbaseID:XB-GENE-950431 Length:535 Species:Xenopus tropicalis

Alignment Length:547 Identity:182/548 (33%)
Similarity:277/548 (51%) Gaps:118/548 (22%)


  Fly     9 LAGLLLLCAT---GASAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPD 70
            |..:||||.|   ...||.|.:||:||||||:.:|||||:|:.|.|:.|::::|:|.||:.||||
 Frog     9 LLSVLLLCCTQPHNVGAWDSGDLELFDLVEEIQQNFYEFLGVEQDASSADIRKAYRKLSLTLHPD 73

  Fly    71 KNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFL 135
            ||..|:|..|||.||:|||||||..||::||.:|..|:|:|:..::||||:||:...|.|.:||:
 Frog    74 KNKEENAETQFRQLVAIYEVLKDEERRQRYDDILVNGLPDWRQPVFYYRRVRKMSNAELALLLFI 138

  Fly   136 ITTVGQYLFAWAAYLEKKYTAEQVFGTKLKKLQK----------KNKNIDMDVILSEIPMPSLLN 190
            |.|||.|..||:.||||:  .:::...|.|:.:|          |:..|:.:..:||  .|...:
 Frog   139 IFTVGHYAVAWSIYLEKQ--LDELLSKKKKEKKKKAGAKTLDEIKSGQIEKNERVSE--KPQWRD 199

  Fly   191 TLPIQIPLALW------NLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLR 249
            .||.:  |.:|      :||:..::......|.:|..| |.::|.||:...|.:::|.:.:.:..
 Frog   200 LLPFK--LGIWFYLTVRSLPQLYQDAKQYYAEYQEKKL-KEKEEAEALAELELIQKEKKPKVKKP 261

  Fly   250 KEHKENLRKRKQNSKAPEKTEEELRGYSQ---IQTRELTDDDAV--RPASQKSTVSGGFWTDEDL 309
            |...........|..||        .|.|   |:..|...||.:  |..:||.....  ||:|||
 Frog   262 KSEFPVYSASTANITAP--------AYDQSASIEDIEEQMDDWLDCRGRNQKKKAPE--WTEEDL 316

  Fly   310 TELIRLVKKYPGGAGSRWNTIAESMNRSVQEVTFMAAKMKE-----------NGYRIPGQTD-SV 362
            ::|.|.:.|:|||...||..||..:.|||.:||..|.::|:           :..:...:.. |:
 Frog   317 SQLTRSMAKFPGGTPGRWEKIAHELGRSVADVTTKAKQVKDAVSCSLGTVRFSDLKCSAKASVSL 381

  Fly   363 AEALV------QESQQAQ------------------RKEKVKKAAANA-----GASAEK------ 392
            :::::      :|.|.::                  ||.|..|.|.:|     |.:.||      
 Frog   382 SDSIITHREEEEEEQDSEEQDLSASQGEGHSTAARVRKRKSTKGATDAVPPLRGEAEEKVRSRRQ 446

  Fly   393 --------------------------SMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANS 431
                                      |:   |..|||.||:.||.|:.:|.| ..|:||.|||..
 Frog   447 RDFDVEQEAEELADSDSDTRKKEQGRSL---EELWTQNQQKLLELALQQYPK-GTGERWDKIAKC 507

  Fly   432 VPEKTKEECLVRYKYLCELVKTQKRAE 458
            ||.|:||:|:.|||.|.|||:.:|:|:
 Frog   508 VPGKSKEDCICRYKLLVELVQKKKQAK 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 36/61 (59%)
SANT 301..>341 CDD:197842 18/40 (45%)
SANT 304..341 CDD:238096 18/37 (49%)
SANT 399..447 CDD:197842 25/48 (52%)
SANT 400..447 CDD:238096 25/47 (53%)
dnajc1NP_001011351.1 DnaJ 43..104 CDD:306689 36/61 (59%)
SANT 310..356 CDD:238096 21/48 (44%)
SANT 478..524 CDD:238096 26/47 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355747835
eggNOG 1 0.900 E1_KOG0724
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 248 1.000 Inparanoid score I3038
OMA 1 1.010
OrthoDB 1 1.010 D412930at33208
OrthoFinder 1 1.000 FOG0004035
OrthoInspector 1 1.000 T1061100
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1934
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.