DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and CG17187

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_650056.1 Gene:CG17187 FlyBaseID:FBgn0037882 Length:299 Species:Drosophila melanogaster

Alignment Length:389 Identity:80/390 (21%)
Similarity:142/390 (36%) Gaps:126/390 (32%)


  Fly    40 NFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANIQ-FRNLVSIYEVLKDPSRREKYDRV 103
            |.|:.:||:..:...|:::|:|..::..||||||.....:: |..|....|:|.|.|.|..||:|
  Fly    10 NLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESARAAYDKV 74

  Fly   104 LKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLKKLQ 168
            ||                                                  |::....:.::|.
  Fly    75 LK--------------------------------------------------AKKAAELRSRQLD 89

  Fly   169 KKNKNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIKNGFSKANELKELALEKRRQELEAVR 233
            .|.:.:.:::   |....:.|:.|....|.:      |:    :|::|      |...:::|.:|
  Fly    90 GKRQKLKLEL---EERERAALHKLAKSQPYS------TV----AKSDE------EVLHEQIERLR 135

  Fly   234 RQ-----EELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELRGYSQIQTRELTDDDAVRPA 293
            |:     ||.:|..:||  .|:.|.|.                     .::|.:.:..|.|....
  Fly   136 REGSRLLEEEQRAMQEQ--FRRNHAEQ---------------------QKLQQQPVQFDSAQHRI 177

  Fly   294 SQKSTVSGGFWTDEDLT--ELIRLVKKYPGGAGSRWNTIAESMNRS---VQEVTFMAAKM---KE 350
            ..|.....|    :|.|  ||::.:|||    |.....:..|..|.   |:..|..|..|   .|
  Fly   178 KMKWKAEPG----QDYTQQELLKYLKKY----GDVVALVVNSKRRGRAMVELATREACDMVLAYE 234

  Fly   351 NGYRIPGQTDSVAEALVQE--SQQAQRKEKVKKAAANAGASAE--KSMLIPETNWTQEQQRALE 410
            .|        ..|:.|..|  :..|..|:..|.|.....||:.  :.:::.:....:|::|.:|
  Fly   235 KG--------DPAKPLHFEWVTPPAADKQTTKSATTGCSASSTDYEDLVMRKLRQAEERKRLIE 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 21/62 (34%)
SANT 301..>341 CDD:197842 12/45 (27%)
SANT 304..341 CDD:238096 11/42 (26%)
SANT 399..447 CDD:197842 3/13 (23%)
SANT 400..447 CDD:238096 3/12 (25%)
CG17187NP_650056.1 DnaJ 10..72 CDD:278647 21/62 (34%)
RRM_DNAJC17 175..247 CDD:240875 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115444339
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.