| Sequence 1: | NP_001285427.1 | Gene: | CG7556 / 32902 | FlyBaseID: | FBgn0030990 | Length: | 522 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001287144.1 | Gene: | Csp / 40459 | FlyBaseID: | FBgn0004179 | Length: | 249 | Species: | Drosophila melanogaster |
| Alignment Length: | 107 | Identity: | 32/107 - (29%) |
|---|---|---|---|
| Similarity: | 54/107 - (50%) | Gaps: | 26/107 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 NFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAE-DANIQFRNLVSIYEVLKDPSRREKYDRV 103
Fly 104 LKEGMPNWKSALYYYRRMRKIGLY-------EGAFILFLITT 138 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7556 | NP_001285427.1 | DnaJ | 40..101 | CDD:278647 | 22/61 (36%) |
| SANT | 301..>341 | CDD:197842 | |||
| SANT | 304..341 | CDD:238096 | |||
| SANT | 399..447 | CDD:197842 | |||
| SANT | 400..447 | CDD:238096 | |||
| Csp | NP_001287144.1 | DnaJ | 17..>86 | CDD:223560 | 26/86 (30%) |
| DnaJ | 17..79 | CDD:278647 | 22/61 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45464385 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||