DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and Csp

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001287144.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster


Alignment Length:107 Identity:32/107 - (29%)
Similarity:54/107 - (50%) Gaps:26/107 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 NFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAE-DANIQFRNLVSIYEVLKDPSRREKYDRV 103
            :.||.:|:.:||||.::|:.:|.|::..||||||.. ||..:|:.:...:.:|.|.::|..||  
  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD-- 79

  Fly   104 LKEGMPNWKSALYYYRRMRKIGLY-------EGAFILFLITT 138
                  |:.|          :|||       |.....|::|:
  Fly    80 ------NYGS----------LGLYIAEQFGEENVNAYFVVTS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 22/61 (36%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
CspNP_001287144.1 DnaJ 17..>86 CDD:223560 26/86 (30%)
DnaJ 17..79 CDD:278647 22/61 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.