DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnajc2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_997976.1 Gene:dnajc2 ZFINID:ZDB-GENE-040426-1912 Length:618 Species:Danio rerio

Alignment Length:588 Identity:136/589 (23%)
Similarity:229/589 (39%) Gaps:192/589 (33%)


  Fly    26 EELEI--------FDLVEEVNRNFYEFMG---INQTATGAEVKRAFRTLSIVLHPDKNPA----- 74
            |||::        .|..:..|::.|..:|   :...||..::|.|.:.:.:..||||..|     
Zfish    63 EELQLEEYPMLKTLDPKDWKNQDHYAVLGLAHVRYKATQKQIKAAHKAMVLKHHPDKRKAAGEQI 127

  Fly    75 -EDANIQFRNLVSIYEVLKDPSRREKYDRV----------LKEGMPNWKS--ALYYYRRMR---- 122
             |..|..|..:....|:|.||.:|..:|.|          ..||..|:..  |..:.|..|    
Zfish   128 VEGDNDYFTCITKAIEILSDPVKRRAFDSVDPTFDNAVPTKAEGKENFFEVFAPVFERNARWSVK 192

  Fly   123 ----KIGLYEGAFILFLITTVGQYLFAW--------AAYLEKKYTAEQVFGTKLKKLQKKN---- 171
                .:|..|.:|     ..|..:...|        .:||:::...:.....:.:.::|:|    
Zfish   193 KHFPSLGTMESSF-----EDVDNFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRASR 252

  Fly   172 ---KNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIK------------------NGFSKAN 215
               |..:|:.|      .:|::|        .:|....||                  ....:..
Zfish   253 AQRKKEEMNRI------RTLVDT--------AYNADPRIKKFKEEEKARKESEKKAKVEAKKREQ 303

  Fly   216 ELKELALEKRRQELEAVR----RQEELEREAEEQARLRKE-HKENLRK----------------- 258
            |.||.|   |:|:.||.|    :|||..|:|.:||:..|| .|:.::|                 
Zfish   304 EEKERA---RQQQEEAARLLKEQQEEAARQAAQQAKKEKEAQKKAIKKERQKLRMTCKSQNYFTD 365

  Fly   259 ----------------------------------RKQNSKAP-EKTEEELRGYSQIQTR---ELT 285
                                              .|:.|||. ||..:|:.  .|:|..   ||.
Zfish   366 NEADSVRMMEEVEKLCDRLELISLQTLNEALSAGNKEQSKAALEKQVQEVN--MQLQKEKDAELQ 428

  Fly   286 DDDAVRPASQKSTVSGG----FWTDEDLTELIRLVKKYPGGAGSRWNTIAESMN--------RSV 338
            ...|.| .|:.|:.:||    .|::|||..||:.|..:|.|..:||..||..||        |:.
Zfish   429 AQQAAR-GSEHSSAAGGQNNRGWSEEDLQLLIKAVNLFPAGTNARWEVIANYMNQHSSSGVRRTA 492

  Fly   339 QEVTFMAAKMKENGYRIPGQTDSVAEALVQESQQ-----------AQRKEKVKKAAANAGASAEK 392
            ::|...|..:::..   |.|.|.:.....::.::           |...|:.....|::.|:|  
Zfish   493 KDVINKAKTLQKLD---PHQKDEINRKAFEKFKKEHSAVPPTVDNAMPSERFDAVGADSNAAA-- 552

  Fly   393 SMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRA 457
                    ||.|:|:.||.|:..| ..:..:||::|:.:||.::|::|:.|||.|.|::|.:|.|
Zfish   553 --------WTTEEQKLLEQALKTY-PVSTAERWERISEAVPGRSKKDCMKRYKELVEMIKAKKAA 608

  Fly   458 EEE 460
            :|:
Zfish   609 QEQ 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 19/70 (27%)
SANT 301..>341 CDD:197842 18/52 (35%)
SANT 304..341 CDD:238096 16/45 (36%)
SANT 399..447 CDD:197842 18/48 (38%)
SANT 400..447 CDD:238096 18/47 (38%)
dnajc2NP_997976.1 ZUO1 72..402 CDD:227594 67/352 (19%)
DnaJ 85..155 CDD:278647 19/70 (27%)
RAC_head 346..416 CDD:293322 8/70 (11%)
SANT 450..504 CDD:197842 18/54 (33%)
SANT 450..502 CDD:238096 18/52 (35%)
SANT 552..601 CDD:197842 21/60 (35%)
SANT 552..599 CDD:238096 20/58 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.