DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnajc2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001186412.1 Gene:dnajc2 XenbaseID:XB-GENE-964533 Length:620 Species:Xenopus tropicalis

Alignment Length:575 Identity:143/576 (25%)
Similarity:235/576 (41%) Gaps:171/576 (30%)


  Fly    27 ELEIFDLVEEV------NRNFYEFMGINQ---TATGAEVKRAFRTLSIVLHPDKNPA------ED 76
            :||.|.|::.:      |::.|..:|:..   .||..::|.|.:.:.:..||||..|      |.
 Frog    67 QLEEFPLLKTLDPKDWKNQDHYAVLGLKNLRYKATQRQIKAAHKAMVLKHHPDKRKAAGEQIVEG 131

  Fly    77 ANIQFRNLVSIYEVLKDPSRREKYDRV----------LKEGMPNWKSAL--YYYRRMR------- 122
            .|..|..:...||:|.||.:|..::.:          ..||..|:..|.  .:.|..|       
 Frog   132 DNDYFTCITKAYEILSDPIKRRAFNSIDPTFDNSIPSKSEGKDNFFDAFSPVFERNSRWSNKKNI 196

  Fly   123 -KIGLYEGAFILFLITTV-GQYLF-----AWA--AYLEKKYTAEQVFGTKLKKLQKKN------- 171
             |:|.....     |..| |.|.|     :|.  :||:::...:.....:.:.::|:|       
 Frog   197 PKLGDMNSC-----IEEVDGFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRAARAQR 256

  Fly   172 KNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIK-----------NGFSKANELKELALEKR 225
            |..:|      |.:.:|::.       |..:.||..|           ...:||:..::...||.
 Frog   257 KKEEM------IRIRTLVDN-------AYSSDPRIKKFKEEEKARKEAEKKAKADARRKEQEEKE 308

  Fly   226 RQ---ELEAVR-RQEELEREAEEQARLRKEHKE----NLRKRKQ--------------NSKAPEK 268
            ||   |||||| .:|:.|.||.:||.|.|:.||    .::|.:|              |.....|
 Frog   309 RQKQAELEAVRLAKEKEEEEARQQALLIKKEKEIQKKAIKKERQRLRTSCKNWNYFSDNEAESVK 373

  Fly   269 TEEEL-------------------------RGYSQIQ----------TRELTDDDAVRPASQK-- 296
            ..||:                         .|.|.::          .||...::|....|.|  
 Frog   374 MMEEIEKLCDRLELASLQSLNESLAVSSKEEGKSAVEKQIAEVNAQLKREKEQEEARMKQSTKGA 438

  Fly   297 --STVSGG----FWTDEDLTELIRLVKKYPGGAGSRWNTIAESMN--------RSVQEVTFMAAK 347
              |.:.||    .|:::||..||:.|..:|.|..:||..||..||        |:.::|...|..
 Frog   439 ENSAIGGGSGSKSWSEDDLQLLIKAVNLFPAGTNARWEVIANYMNLHSISGIKRTSKDVINKAKS 503

  Fly   348 MKENGYRIPGQTDSVAEALVQESQQAQRKEKVKKAAANA-------GASAEKSMLIPETNWTQEQ 405
            :::..   |.|.|.:.:....:.::..|  .|.::..||       |.:|:.|      .||.|:
 Frog   504 LQKLD---PQQKDDINKKAFDKFKKEHR--VVPQSVDNAVPSERFEGPAADMS------PWTTEE 557

  Fly   406 QRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEE 460
            |:.||.|:..|.... .:||:|||.:||.::|::|:.|||.|.|:||.:|.|:|:
 Frog   558 QKLLEQALKTYPVNT-PERWEKIAEAVPGRSKKDCMKRYKELVEMVKAKKAAQEQ 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 20/70 (29%)
SANT 301..>341 CDD:197842 17/52 (33%)
SANT 304..341 CDD:238096 15/45 (33%)
SANT 399..447 CDD:197842 20/48 (42%)
SANT 400..447 CDD:238096 20/47 (43%)
dnajc2NP_001186412.1 ZUO1 73..416 CDD:227594 78/361 (22%)
DnaJ 86..156 CDD:278647 20/70 (29%)
RAC_head 347..417 CDD:293322 8/70 (11%)
SANT 552..601 CDD:197842 22/50 (44%)
SANT 552..599 CDD:238096 21/48 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.