DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and CG2790

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_611986.2 Gene:CG2790 FlyBaseID:FBgn0027599 Length:540 Species:Drosophila melanogaster

Alignment Length:608 Identity:127/609 (21%)
Similarity:207/609 (34%) Gaps:215/609 (35%)


  Fly    39 RNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNP--AEDANIQFRNLVSIYEVLKDPSRREKYD 101
            |.:||.:.:.:.|...::|.|:|.:::..||||||  ..:|..:|:.:...||||.||..|..||
  Fly     2 RCYYEELELQRNANDGDIKSAYRKMALRWHPDKNPDRLAEAKERFQLIQQAYEVLSDPQERSWYD 66

  Fly   102 RVLKEGMPNWKSALY-------------------------YYRRMRKIGLYEGAFILFLI----- 136
            . .:|.:...|::.|                         :||      :|...|:....     
  Fly    67 N-HREQILRGKNSDYAENCLDVFQFFTSSCYKGYGDNEHGFYR------VYTDVFVQIASEDLEF 124

  Fly   137 ---------------------TTVGQYLFAWAAYLEKK-------YTAEQVFGTK----LKKLQK 169
                                 ..||.:...|.||..:|       |...::   |    |:|::|
  Fly   125 MDKDDRLGMAPDFGHSNSSYEDVVGPFYAFWQAYSTRKTYDWLCPYDVREI---KERFILRKVEK 186

  Fly   170 KNKNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIKNGFSKANELKELA--LEKRRQELEAV 232
            :.|.|                   :|       ..|..:|     .|::.|.  :.||...::|.
  Fly   187 EMKKI-------------------VQ-------AARKERN-----EEVRNLVNFVRKRDPRVQAY 220

  Fly   233 RRQEELEREAEEQARLRKE--HKENLRKRKQNSKAPEKT-------EEELRGYSQ---IQTRELT 285
            ||..|   |..|..||::|  .||.||||::...|..|.       ||:|:...|   .::.:.|
  Fly   221 RRMLE---ERVEANRLKQEEKRKEQLRKRQEELAAVRKNNVFNEGYEEQLKQLEQQYDSKSEDYT 282

  Fly   286 DDDAVRPASQKSTVSGGFWTDEDLTELIR-----LVKKYPGGAGSRWN-----TIAESMNRSVQE 340
            |:|......:.....||...:|...|.:.     ...|....|.:|.|     ...|:::|..||
  Fly   283 DEDENDDDGEDFDHEGGQEAEEYEVEYVDDLYCVACNKTFKNAKARANHEESKKHNENVDRLCQE 347

  Fly   341 VTFMAAKMKENGYR-------IPGQTDSVAEALV-------------QESQQAQRKEKVKKAAAN 385
            :     :.:|:.:.       :.|..:|:.|..|             :||..|:|.:|.|||..:
  Fly   348 M-----EEEEDAFHNEPHEDSLMGVQESLEELQVSEDQISFDGVPSEEESSLAKRTKKNKKARKS 407

  Fly   386 A--GASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLC 448
            |  .|.||.|         .|....:|...:|  ..:..:.|.| .....:|:|.:.....|.  
  Fly   408 AVKQAQAEGS---------DEPDEPIEKKAIK--SESEDEDWSK-GKKASKKSKSKKTTTRKV-- 458

  Fly   449 ELVKTQKRAEEEANEPDEDAAAIEEELPEEE---------------------------------- 479
                  |..|:..:||:...|.:..:..:|:                                  
  Fly   459 ------KLLEQTVSEPNTKEATVAPKSGDEDLDPTKSQHTCVTCRLVFDSKNKLFAHLKKTNHGV 517

  Fly   480 --PLAPPEPEVAPAAKKLSKREQ 500
              |.|.|..|..|..|...||.:
  Fly   518 YIPKAKPNVEGKPPGKAKGKRNK 540

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 22/63 (35%)
SANT 301..>341 CDD:197842 12/50 (24%)
SANT 304..341 CDD:238096 10/47 (21%)
SANT 399..447 CDD:197842 8/48 (17%)
SANT 400..447 CDD:238096 8/47 (17%)
CG2790NP_611986.2 DnaJ 3..66 CDD:278647 22/63 (35%)
ZUO1 19..>252 CDD:227594 62/277 (22%)
zf-C2H2_jaz 313..337 CDD:288983 4/24 (17%)
C2H2 Zn finger 315..337 CDD:275371 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115227000
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.