DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Rme-8

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_610467.1 Gene:Rme-8 FlyBaseID:FBgn0015477 Length:2408 Species:Drosophila melanogaster

Alignment Length:566 Identity:103/567 (18%)
Similarity:189/567 (33%) Gaps:197/567 (35%)


  Fly    22 AWHSEELEIFDLVEE-----VNRNFYEFMGINQTAT----GAEVKRAFRTLSIVLHPDKNPAEDA 77
            ||..|       ||:     ..:..|:.:||:.|.|    .:.:::::..|:.:.||||||  :.
  Fly  1286 AWRKE-------VEKKPPQMTIQQAYQDLGIDLTKTPKPDESMIRKSYYKLAQMYHPDKNP--NG 1341

  Fly    78 NIQFRNLVSIYEVL----------KDPSR-----------REKYDRVLKEGMPNWKSALYYYRRM 121
            ...|..:...||.|          .||:.           .|:|..||:.    :|.| .|.:.:
  Fly  1342 REIFEKVNQAYEFLCSRNVWSSGGPDPNNIVLILRTQSILFERYPDVLRP----YKYA-GYPQLI 1401

  Fly   122 RKIGLYEGAFILF-----LITTVGQYLF-----------------AWAAYLEKKYTAEQVFGTKL 164
            :.|.|......||     |:|...:..:                 ...|.||.......:.|...
  Fly  1402 KTIRLETRDDELFSKEAQLLTAASELCYHTVHCSALNAEELRREEGIEALLEAYTRCVSILGVDS 1466

  Fly   165 K--------------------KLQK-KNKNIDMDVILSEI-------------PMPSL-LNTLPI 194
            |                    ..:| |.|.|.:..:||::             .:.|| .|...:
  Fly  1467 KPDSLHYQVISNVTRCFEVACNFEKCKQKIIQLPQLLSDVCRVVYFKHTLSVSLVTSLAANNYDL 1531

  Fly   195 QIPLA----LWNLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKEN 255
            |..|:    ||:|...|..        .:..|::...::.....|::|.....:.|.|..     
  Fly  1532 QCQLSRNGVLWSLLLFIFE--------YDYTLDESGVDVSDKSNQQQLANNLAKMAVLGC----- 1583

  Fly   256 LRKRKQNSKAPEKTEEELRGYS-QIQTRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKY 319
                           ..|.||| :::.:.:|..:...||::...|                :|..
  Fly  1584 ---------------IALAGYSMELRQKPVTGSETNSPAAKAPPV----------------IKPK 1617

  Fly   320 PGGAGSRWNTIAESMNRSVQ--EVTFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKEKVKKA 382
            |..:.:..:|..::.:..:|  ::...:.|.||:. ...|.:|: |.:...||:|.|:..|.:.:
  Fly  1618 PSVSAASSSTYTQNAHNPLQSKQLAITSGKEKESD-TSSGSSDT-ASSTPTESEQQQQLTKTRTS 1680

  Fly   383 AAN----AGASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECL-- 441
            |..    ....|:.|::          ::.|:..:.:|           |:|.:......:.|  
  Fly  1681 AIQQKYIVTGEAKNSLI----------KQVLDRLLTRY-----------ISNQLATVRDSDVLKL 1724

  Fly   442 ----VRYKYLC----------ELVKTQKRAEEEANEPDEDAAAIEE 473
                .|..||.          :.::.|:.|  .|.|..||.|.:.|
  Fly  1725 LTANTRNPYLIWDNGTRAQLKDFLEQQRTA--SAKETHEDIAQVSE 1768

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 20/86 (23%)
SANT 301..>341 CDD:197842 4/42 (10%)
SANT 304..341 CDD:238096 4/39 (10%)
SANT 399..447 CDD:197842 7/54 (13%)
SANT 400..447 CDD:238096 7/53 (13%)
Rme-8NP_610467.1 DUF4339 972..1020 CDD:290937
DnaJ 1304..1356 CDD:278647 16/54 (30%)
HEAT repeat 2174..2200 CDD:293787
HEAT repeat 2212..2243 CDD:293787
HEAT repeat 2253..2282 CDD:293787
HEAT repeat 2291..2327 CDD:293787
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115407142
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.