DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Tpr2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001260501.1 Gene:Tpr2 FlyBaseID:FBgn0032586 Length:508 Species:Drosophila melanogaster

Alignment Length:77 Identity:21/78 (27%)
Similarity:44/78 (56%) Gaps:6/78 (8%)


  Fly    31 FDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDA------NIQFRNLVSIYE 89
            |.|.:...:::|:.:||.:.|:..|:|:|:|..::|.|||::....|      .::|:.:...|.
  Fly   393 FALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYA 457

  Fly    90 VLKDPSRREKYD 101
            :|.|..::.:||
  Fly   458 ILSDAHKKSRYD 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 18/67 (27%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
Tpr2NP_001260501.1 TPR_11 49..114 CDD:290150
TPR repeat 49..77 CDD:276809
TPR repeat 82..112 CDD:276809
TPR_11 201..262 CDD:290150
TPR repeat 201..225 CDD:276809
TPR_1 231..264 CDD:278916
TPR repeat 231..259 CDD:276809
TPR_11 278..345 CDD:290150
TPR repeat 310..344 CDD:276809
TPR_11 314..380 CDD:290150
TPR repeat 349..377 CDD:276809
DnaJ 401..>503 CDD:223560 19/70 (27%)
DnaJ 402..469 CDD:278647 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115227016
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.