DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and CG40178

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001015187.2 Gene:CG40178 FlyBaseID:FBgn0058178 Length:780 Species:Drosophila melanogaster

Alignment Length:550 Identity:101/550 (18%)
Similarity:179/550 (33%) Gaps:201/550 (37%)


  Fly    12 LLLLCATGASAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAED 76
            :|:||.|          ....:...:| :.|..:|||:.||..|::.|::.|:...||||...:.
  Fly    13 ILVLCTT----------SYIHVCSSLN-DPYAILGINKKATTYEIREAYKELAKKWHPDKVKNDY 66

  Fly    77 ANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQ 141
            ...:|..:...||:|.|..||..:||.   |:.:..|  .|:::......|....:.......||
  Fly    67 GAEKFIQIKLAYEILADLDRRRIFDRY---GVSDINS--QYFQKKHDYSEYNRFTLNQNDDDFGQ 126

  Fly   142 -------YLFAWAAYLEKKYTAEQVFGTKLKKLQ----------KKNKNIDMDVILSEIPMPSLL 189
                   ..|.....:.:.|..:.:.....||:.          |..:.:|....:.|:..|..:
  Fly   127 RFDIKQDIAFYQKLSITENYFEKMILSKNAKKVHVVMFYNDWCFKCTRIVDAFKKILELLQPIGI 191

  Fly   190 NTLPIQIPLALWNLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKE 254
            |                    |:..|.:.|.::.::.    ..|...:|....:.|..|.::|  
  Fly   192 N--------------------FATVNAVHEESVFRKC----GAREVPQLVLILDNQYFLYRDH-- 230

  Fly   255 NLRKRKQNSKAPEKTEEELRG------YSQIQTRELTDDDAVRPASQKSTVSGGFWTD------- 306
                    |..|:|..|.:|.      :.:|:.....|            ..|| |:|       
  Fly   231 --------SFTPQKVVEFIRKKIPFNVFKRIEHDNFND------------FLGG-WSDNRARALI 274

  Fly   307 ---EDLTELIRLV---KKYPGGAGSRWNTIAE---------SMNRSVQEV--------TFMAAKM 348
               ..||.|..|:   :.|...|....|||::         .:|.|:..:        ||.|:..
  Fly   275 FEPRSLTRLRYLLTAFEFYDRVAFGFVNTISKDSSNIITRFKVNTSLDTLILFNEDTTTFTASVC 339

  Fly   349 KENGYRIPG------------------QTDSVAEALVQESQQAQRK----------------EKV 379
            .|   .||.                  .:.::.|::.......|||                |:|
  Fly   340 ME---EIPNHILVNMVSTNQFLAFPRISSQNIMESVCPTEWNRQRKHLCVILITENNRKKDFERV 401

  Fly   380 --KKAAANAGASAEK---SMLIPETN----------------------WTQEQQRALEAAIVKYR 417
              :..|.:.|.::||   :.:..|:.                      |.::::|      :|| 
  Fly   402 ALRNIALSVGYNSEKVRFAYIFKESQPDFIKSISKGSFKDSLIEIVIIWRRDKKR------IKY- 459

  Fly   418 KTAGGDRWQKIA----NSVPE----KTKEE 439
                  .|..:|    ||.||    .||::
  Fly   460 ------NWVYVAKQNGNSSPEHLMNSTKDQ 483

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 20/61 (33%)
SANT 301..>341 CDD:197842 15/62 (24%)
SANT 304..341 CDD:238096 13/59 (22%)
SANT 399..447 CDD:197842 12/71 (17%)
SANT 400..447 CDD:238096 12/70 (17%)
CG40178NP_001015187.2 DnaJ 30..>94 CDD:223560 22/67 (33%)
DnaJ 30..91 CDD:278647 20/61 (33%)
TRX_DnaJ 134..244 CDD:239261 22/144 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115892367
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.