DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and CG7872

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster

Alignment Length:331 Identity:80/332 (24%)
Similarity:132/332 (40%) Gaps:88/332 (27%)


  Fly     7 LTLAGLLLLCATGASAWHSEELEIFDLVEEV---NRNFYEFMGINQTATGAEVKRAFRTLSIVLH 68
            |.|..||...|.|             |:|.:   ..|.|:.:|:.:.::.:|:.:|:|.|:...|
  Fly     8 LVLLALLPTMALG-------------LLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYH 59

  Fly    69 PDKNPAED----ANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALY--YYRR--MRKIG 125
            ||.:...:    |..||:.:.:.||:|:|...|..||.:|..  |:...|.|  ||||  ..|:.
  Fly    60 PDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDYMLDN--PDAYYAHYYRYYRRRVAPKVD 122

  Fly   126 LYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLK---------------KLQKKNKN-- 173
            :.....::..|.:|.||...|..|    .:|.:.|.|..|               |:|||.||  
  Fly   123 VRVVIVVVLTIVSVIQYYSGWQRY----DSAIKYFATVPKYRNQALEIARDEIQEKIQKKGKNRM 183

  Fly   174 ------IDMDVILSEI-----------PMPSLLNTLPIQIPLALWNLPRTI-------KNGFSKA 214
                  .:::.|:..:           ..|:|.:.|.:|:.:.    |.||       ...|.:.
  Fly   184 SKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIIC----PYTILSFIVWHAQWFWRY 244

  Fly   215 NELKELALEKRRQELEAVRR-----QEELERE----AEEQARLRKEHKENL--RKRKQNSKAPEK 268
            ..:|:  ...|.|:|..:||     |.:.|.:    .||...|:...:||.  .|.:|..:..:|
  Fly   245 TVMKQ--PYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQEEEMKKK 307

  Fly   269 TEEELR 274
            ..|..|
  Fly   308 LAENPR 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 19/65 (29%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
CG7872NP_573044.1 DnaJ 31..96 CDD:278647 19/65 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C115599393
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.