DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Zzz3

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001128021.2 Gene:Zzz3 RGDID:1565468 Length:909 Species:Rattus norvegicus

Alignment Length:362 Identity:73/363 (20%)
Similarity:125/363 (34%) Gaps:104/363 (29%)


  Fly   164 LKKLQKKNKNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIKNGFSKANELKELALEKRRQE 228
            ::|||||     .|:   .:|.|..:    :|:|..:|:...:....|.:  |.|......||.:
  Rat   548 VEKLQKK-----ADI---GLPYPQRV----VQLPEIVWDQYTSSLGNFER--EFKHRKRHTRRVK 598

  Fly   229 LEAVRRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELRGYSQIQTRELTDDDAVRPA 293
            |..                    .|..|..|.::...|:|..:.| .||.:...:..:....||.
  Rat   599 LVF--------------------DKVGLPARPKSPLDPKKDGDSL-SYSMLPLSDGPEGSHHRPQ 642

  Fly   294 --------SQKSTVSGGFWTDEDLTELIRLVKKYPGG--AGSRWNTIAESM-NRSVQEVTFMA-- 345
                    ..|.......||.|:..:|.:|:.|||..  ...||..||:.: ||:.::|....  
  Rat   643 MIRGRLCDDSKPETFNQLWTVEEQKKLEQLLLKYPPEEVESRRWQKIADELGNRTAKQVASRVQK 707

  Fly   346 --AKMKENGYRIPGQTDSVAEALVQESQQAQRKEKVKKAAANAGASAEKSMLIPETNWTQEQQRA 408
              .|:.:.|..:||:|.:: ....::|..::|:..:           .|.:..|.|..|..:...
  Rat   708 YFIKLTKAGIPVPGRTPNL-YIYSRKSSTSRRQHPL-----------NKHLFKPSTFMTSHEPPV 760

  Fly   409 LEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEEANEPDEDAAAIEE 473
            .                      :.|..:..|...:         ...|.|||:: :|....|..
  Rat   761 Y----------------------MDEDDERSCPHSH---------MSTAVEEASD-EESIPVIYR 793

  Fly   474 ELPEEEPLAPPEPEVAPAAKKLSKREQRRRKRDLSSG 510
            .|||.:.|.        ..|||.|  |:.::....||
  Rat   794 SLPEYKELL--------QFKKLKK--QKLQQMQAESG 820

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647
SANT 301..>341 CDD:197842 14/43 (33%)
SANT 304..341 CDD:238096 14/40 (35%)
SANT 399..447 CDD:197842 4/48 (8%)
SANT 400..447 CDD:238096 3/47 (6%)
Zzz3NP_001128021.2 SANT 661..711 CDD:197842 15/50 (30%)
Myb_DNA-binding 661..708 CDD:278669 15/47 (32%)
ZZ_ZZZ3 827..877 CDD:239081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.