DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and DNAJC2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_055192.1 Gene:DNAJC2 HGNCID:13192 Length:621 Species:Homo sapiens

Alignment Length:563 Identity:136/564 (24%)
Similarity:228/564 (40%) Gaps:148/564 (26%)


  Fly    27 ELEIFDLVEEV------NRNFYEFMGINQT---ATGAEVKRAFRTLSIVLHPDKNPA------ED 76
            :||.|.:::.:      |::.|..:|:...   ||..::|.|.:.:.:..||||..|      |.
Human    69 QLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEG 133

  Fly    77 ANIQFRNLVSIYEVLKDPSRREKY---DRVLKEGMPN---------------------WKSALYY 117
            .|..|..:...||:|.||.:|..:   |......:|:                     |.:.   
Human   134 DNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNK--- 195

  Fly   118 YRRMRKIGLYEGAFILFLITTVGQYLF-AWA--AYLEKKYTAEQVFGTKLKKLQKKNKNIDMDVI 179
             :.:.|:|....:|....|.....|.| :|.  :||:::...:.....:.:.::|:|:.......
Human   196 -KNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRK 259

  Fly   180 LSEIPMPSLLNTLPIQIPLALWNLPR-------------TIKNGFSKANELKELALEKRRQ-ELE 230
            ..|      :|.:...:..|....||             ..|...::|...::.|.||:|| |||
Human   260 KEE------MNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELE 318

  Fly   231 AVR-RQEELEREAEEQARLRKEHKENLRK--RKQNSK---------------------------- 264
            |.| .:|:.|.|..:||.|.|:.|:..:|  :|:..|                            
Human   319 AARLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKTWNHFSDNEAERVKMMEEVEKL 383

  Fly   265 --------------------------APEKTEEELRGYSQIQTRELTDDDAVRPAS---QKSTVS 300
                                      |.||..||:.  .||:..:...:..:|.||   :|||..
Human   384 CDRLELASLQCLNETLTSCTKEVGKAALEKQIEEIN--EQIRKEKEEAEARMRQASKNTEKSTGG 446

  Fly   301 GG----FWTDEDLTELIRLVKKYPGGAGSRWNTIAESMN--------RSVQEVTFMAAKMKENGY 353
            ||    .|:::||..||:.|..:|.|..|||..||..||        |:.::|...|..:::.. 
Human   447 GGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLD- 510

  Fly   354 RIPGQTDSVAEALVQESQQAQRKEKVKKAAANAGASAE-KSMLIPETNWTQEQQRALEAAIVKYR 417
              |.|.|.:.:   :...:.:::..|...|.||..|.. :......|.||.|:|:.||.|:..|.
Human   511 --PHQKDDINK---KAFDKFKKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYP 570

  Fly   418 KTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEE 460
            ... .:||:|||.:||.:||::|:.|||.|.|:||.:|.|:|:
Human   571 VNT-PERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQ 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 20/73 (27%)
SANT 301..>341 CDD:197842 18/52 (35%)
SANT 304..341 CDD:238096 16/45 (36%)
SANT 399..447 CDD:197842 22/48 (46%)
SANT 400..447 CDD:238096 21/47 (45%)
DNAJC2NP_055192.1 Epitope (recognized by CD8(+) cytotoxic T-lymphocytes) 23..31
ZUO1 75..368 CDD:227594 63/303 (21%)
DnaJ 88..158 CDD:278647 20/70 (29%)
ZRF1-UBD 160..250 13/94 (14%)
RAC_head 349..420 CDD:293322 7/73 (10%)
SANT 452..508 CDD:197842 18/56 (32%)
SANT 453..506 CDD:238096 18/53 (34%)
SANT 551..602 CDD:197842 24/52 (46%)
SANT 553..600 CDD:238096 22/48 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.