DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and SPAC2E1P5.03

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_594141.1 Gene:SPAC2E1P5.03 PomBaseID:SPAC2E1P5.03 Length:303 Species:Schizosaccharomyces pombe

Alignment Length:305 Identity:70/306 (23%)
Similarity:117/306 (38%) Gaps:72/306 (24%)


  Fly    12 LLLLCATGASAWHSEELEIFDLVEEV------NRNFYEFMGINQTATGAEVKRAFRTLSIVLHPD 70
            :|||......||.|.:||||.:|:.:      ...|||.:.:...|:..|:.||:|..||:.|||
pombe     6 ILLLLFGVCLAWTSSDLEIFRVVDSLKSILKNKATFYELLEVPTKASIKEINRAYRKKSILYHPD 70

  Fly    71 KNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFL 135
            |||..........|  |..:|::...|::||..||.|.|.||...|.|.|.|. ||.....:|||
pombe    71 KNPKSKELYTLLGL--IVNILRNTETRKRYDYFLKNGFPRWKGTGYLYSRYRP-GLGAVLVLLFL 132

  Fly   136 ITTVGQYL-------------------------FAWAAYLEKK----------YTAEQVFGTKLK 165
            :.::..::                         :|.:|...|:          ||.:.:.|... 
pombe   133 LISIAHFVMLVISSKRQKKIMQDHIDIARQHESYATSARGSKRIVQVPGGRRIYTVDSITGQVC- 196

  Fly   166 KLQKKNKNIDMDVILSEIPMPSLLNTLPIQIP-LALWNLPRTIKNGFSKANELKELALEKRRQEL 229
             :...:.||:..|....:....:.:|...::| ..:||   .....|::|....|          
pombe   197 -ILDPSSNIEYLVSPDSVASVKISDTFFYRLPRFIVWN---AFGRWFARAPASSE---------- 247

  Fly   230 EAVRRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELR 274
                       :.:...::..|.|.: ...|.:..:|.|.|..::
pombe   248 -----------DTDSDGQMEDEEKSD-SVHKSSFSSPSKKEASIK 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 21/61 (34%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
SPAC2E1P5.03NP_594141.1 CbpA 34..261 CDD:225124 55/256 (21%)
DnaJ 40..99 CDD:278647 21/61 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004035
OrthoInspector 1 1.000 T1125757
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR44653
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1934
TreeFam 00.000 Not matched by this tool.
44.130

Return to query results.
Submit another query.