DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and rsp1

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_595625.1 Gene:rsp1 PomBaseID:SPBC11B10.05c Length:494 Species:Schizosaccharomyces pombe

Alignment Length:511 Identity:104/512 (20%)
Similarity:177/512 (35%) Gaps:168/512 (33%)


  Fly    21 SAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANI--QFRN 83
            :|:|.|.::           :|..:|...|::..|:::.:..|.:..|||:||..:|.:  ||:.
pombe     4 TAFHDEFVD-----------YYTILGAESTSSYVEIRQQYLKLVLRYHPDRNPGREAEVLPQFQL 57

  Fly    84 LVSIYEVLKDPSRREKYD--RVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAW 146
            :...:||||||..||.:|  |:|:.|.|:  ..|.:  |.:|.|....      |:|        
pombe    58 IQKAHEVLKDPKLRELFDQRRLLEAGRPD--GVLRF--RPKKSGPKND------IST-------- 104

  Fly   147 AAYLEKKYTAEQVFGTKLKKLQKKNKNIDMDVILSEIPMPSLLNTLPIQIPLALWNLPRTIKNGF 211
                   ..|.:|..|...|..:|.|..|.:                               |..
pombe   105 -------KVASKVSVTMATKFAEKKKKQDRE-------------------------------NVD 131

  Fly   212 SKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELRGY 276
            ||.|.:...:|.:   ...|..:.|                |.|..|....||:...:     ||
pombe   132 SKDNNITNFSLHR---SFSASGKME----------------KNNSFKEVSTSKSYISS-----GY 172

  Fly   277 SQIQTRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKYPGGAGSRWNTIAESMNRSVQEV 341
            ...:|         .|..:|:    |:.| |::.:.|....::.|...:::|  |:....|::|.
pombe   173 LHPKT---------SPIFKKN----GYAT-ENVVDPISSSPRFKGPNYNKFN--AKLYLESLREK 221

  Fly   342 --TFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKEKVKKAAANAGASAEKSMLIPETNWTQE 404
              |:.......||....|..:|........|..:...|:.|.       ::|:|::....| |.|
pombe   222 RRTYTPLSEISNGLNSNGVENSSITKSSPRSSSSSNNERFKD-------TSEESIIFTSPN-TPE 278

  Fly   405 QQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEEANEPDEDAA 469
            .....:..|....|....|      |:.|.|.:    :.:::                       
pombe   279 HPSVYQTDITPEIKLEHSD------NNSPSKPE----IPFRH----------------------- 310

  Fly   470 AIEEELPEEEPLAPPEPEVAPAAKKLSKREQRRRKRDLSSGEDS-------DDAYQ 518
                  |..:|| ||:|.....:..||:.:.|.:..|||:..||       ||..|
pombe   311 ------PTSKPL-PPKPLSRSKSSSLSRNQTRSQLNDLSAENDSTSNSTEYDDQLQ 359

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 21/63 (33%)
SANT 301..>341 CDD:197842 9/40 (23%)
SANT 304..341 CDD:238096 8/37 (22%)
SANT 399..447 CDD:197842 9/48 (19%)
SANT 400..447 CDD:238096 9/47 (19%)
rsp1NP_595625.1 DnaJ 12..75 CDD:278647 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1800
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.