DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Dnajc2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_033610.1 Gene:Dnajc2 MGIID:99470 Length:621 Species:Mus musculus

Alignment Length:567 Identity:141/568 (25%)
Similarity:235/568 (41%) Gaps:156/568 (27%)


  Fly    27 ELEIFDLVEEV------NRNFYEFMG---INQTATGAEVKRAFRTLSIVLHPDKNPA------ED 76
            :||.|.:::.:      |::.|..:|   :..|||..::|.|.:.:.:..||||..|      |.
Mouse    69 QLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYTATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEG 133

  Fly    77 ANIQFRNLVSIYEVLKDPSRREKY---DRVLKEGMPN---------------------WKSALYY 117
            .|..|..:...||:|.||.:|..:   |......:|:                     |.:.   
Mouse   134 DNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFQVFSPVFERNSRWSNK--- 195

  Fly   118 YRRMRKIGLYEGAFILFLITTVGQYLFAW--------AAYLEKKYTAEQVFGTKLKKLQKKNKNI 174
             :.:.|:|....:|     ..|..:...|        .:||:::...:.....:.|.::|:|:..
Mouse   196 -KNVPKLGDMNSSF-----EDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRAT 254

  Fly   175 DMDVILSEIPMPSLLNTLPIQIPLALWNLPR-------------TIKNGFSKANELKELALEKRR 226
            .......|      :|.:...:..|....||             ..|...::|...::.|.||:|
Mouse   255 RAQRKKEE------MNRIRTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEARRKEQEAKEKQR 313

  Fly   227 Q-ELEAVR-RQEELEREAEEQARLRKEHKE----NLRKRKQ---NS---------------KAPE 267
            | |||||| .:|:.|.|..:||.|.|:.|:    .::|.:|   ||               |..|
Mouse   314 QAELEAVRLAKEKEEEEVRQQALLAKKEKDIQKKAIKKERQKLRNSCKSWNHFSDNEADRVKMME 378

  Fly   268 KTEE--------ELRGYSQI---QTREL---------------------TDDDAVRPAS---QKS 297
            :.|:        .|:|.::|   .|||:                     ..|..:|.||   :||
Mouse   379 EVEKLCDRLELASLQGLNEILASSTREVGKAALEKQIEEVNEQMRREKEEADARMRQASKNAEKS 443

  Fly   298 TVSGGF----WTDEDLTELIRLVKKYPGGAGSRWNTIAESMN--------RSVQEVTFMAAKMKE 350
            |...|.    |:::||..||:.|..:|.|..|||..||..||        |:.::|...|..:::
Mouse   444 TGGSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVISKAKSLQK 508

  Fly   351 NGYRIPGQTDSVAEALVQESQQAQRKEKVKKAAANAGASAEK--SMLIPETNWTQEQQRALEAAI 413
            ..   |.|.|.:.:....:.    :||....:.|::.|.:|:  ...|..|.||.|:|:.||.|:
Mouse   509 LD---PHQKDDINKKAFDKF----KKEHGVASQADSAAPSERFEGPCIDSTPWTTEEQKLLEQAL 566

  Fly   414 VKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEE 460
            ..|.... .:||:|||.:||.:||::|:.|||.|.|:||.:|.|:|:
Mouse   567 KTYPVNT-PERWEKIAEAVPGRTKKDCMRRYKELVEMVKAKKAAQEQ 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 21/73 (29%)
SANT 301..>341 CDD:197842 17/52 (33%)
SANT 304..341 CDD:238096 16/45 (36%)
SANT 399..447 CDD:197842 22/48 (46%)
SANT 400..447 CDD:238096 21/47 (45%)
Dnajc2NP_033610.1 ZUO1 75..368 CDD:227594 65/308 (21%)
DnaJ 88..158 CDD:278647 21/70 (30%)
ZRF1-UBD 160..250 12/99 (12%)
RAC_head 349..420 CDD:293322 13/71 (18%)
SANT 452..508 CDD:197842 18/56 (32%)
SANT 453..506 CDD:238096 18/53 (34%)
SANT 552..602 CDD:197842 24/51 (47%)
SANT 553..600 CDD:238096 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.