DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and C47A4.1

DIOPT Version :10

Sequence 1:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_502648.2 Gene:C47A4.1 / 183525 WormBaseID:WBGene00008122 Length:157 Species:Caenorhabditis elegans


Alignment Length:138 Identity:28/138 - (20%)
Similarity:50/138 - (36%) Gaps:49/138 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KKNKNIDMDVILSEI-----------PMPSLLNTL---PIQIPL---------ALWNLPRTIKNG 210
            ||||.:|.|.::.:|           ...|:.:||   .|..||         |||.....|:. 
 Worm     8 KKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWTALWYWRFAIQK- 71

  Fly   211 FSKANELKELALEKR-----RQELEAVRRQEEL-------------------EREAEEQARLRKE 251
             .:.::..:|.|.::     :.|.:.....|::                   ||:|.||.::.:.
 Worm    72 -EEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKTNCATWKAERDAAEQEKMAQS 135

  Fly   252 HKENLRKR 259
            .:....||
 Worm   136 GRYKRYKR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_573354.1 DnaJ 40..101 CDD:395170
SANT 304..341 CDD:238096
SANT 400..447 CDD:238096
C47A4.1NP_502648.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.