powered by:
Protein Alignment CG7556 and C47A4.1
DIOPT Version :9
| Sequence 1: | NP_001285427.1 |
Gene: | CG7556 / 32902 |
FlyBaseID: | FBgn0030990 |
Length: | 522 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_502648.2 |
Gene: | C47A4.1 / 183525 |
WormBaseID: | WBGene00008122 |
Length: | 157 |
Species: | Caenorhabditis elegans |
| Alignment Length: | 138 |
Identity: | 28/138 - (20%) |
| Similarity: | 50/138 - (36%) |
Gaps: | 49/138 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 169 KKNKNIDMDVILSEI-----------PMPSLLNTL---PIQIPL---------ALWNLPRTIKNG 210
||||.:|.|.::.:| ...|:.:|| .|..|| |||.....|:.
Worm 8 KKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWTALWYWRFAIQK- 71
Fly 211 FSKANELKELALEKR-----RQELEAVRRQEEL-------------------EREAEEQARLRKE 251
.:.::..:|.|.:: :.|.:.....|:: ||:|.||.::.:.
Worm 72 -EEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKTNCATWKAERDAAEQEKMAQS 135
Fly 252 HKENLRKR 259
.:....||
Worm 136 GRYKRYKR 143
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C160164687 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.