DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnj-7

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_509209.1 Gene:dnj-7 WormBaseID:WBGene00001025 Length:491 Species:Caenorhabditis elegans

Alignment Length:95 Identity:25/96 (26%)
Similarity:50/96 (52%) Gaps:9/96 (9%)


  Fly    17 ATGASAWHSEELEIFDLVEEV-----NRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAED 76
            ||..:..|.|..|..:..:.:     .|::|:.:|:.:.|:..|:.:|:|.|:...|||....|:
 Worm   351 ATEVNPDHREAKEGLEHAKRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEE 415

  Fly    77 ----ANIQFRNLVSIYEVLKDPSRREKYDR 102
                |..:|.::.:..|||:|..:|.::|:
 Worm   416 EKKKAEKKFIDIAAAKEVLQDEEKRRQFDQ 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 18/65 (28%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
dnj-7NP_509209.1 TPR_11 29..91 CDD:290150
TPR repeat 29..54 CDD:276809
TPR repeat 59..89 CDD:276809
TPR_1 60..93 CDD:278916
TPR_11 61..124 CDD:290150
TPR 77..360 CDD:223533 3/9 (33%)
TPR repeat 94..121 CDD:276809
TPR repeat 140..168 CDD:276809
TPR repeat 173..203 CDD:276809
TPR repeat 208..236 CDD:276809
TPR repeat 324..354 CDD:276809 2/3 (67%)
TPR_1 325..358 CDD:278916 2/7 (29%)
DnaJ 377..>445 CDD:223560 20/68 (29%)
DnaJ 379..444 CDD:278647 18/65 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114679458
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.