DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnj-11

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_501006.1 Gene:dnj-11 WormBaseID:WBGene00001029 Length:589 Species:Caenorhabditis elegans

Alignment Length:524 Identity:117/525 (22%)
Similarity:218/525 (42%) Gaps:136/525 (26%)


  Fly    38 NRNFYEFMGINQ---TATGAEVKRAFRTLSIVLHPDKNPAEDANIQ----FRNLVSIYE-VLKDP 94
            |::.|:.:|:::   .||..|::..:|...:..||||.......::    |..:...|| |....
 Worm    96 NQDHYKVLGLSKLRWQATSDEIRFCYRQKVLKHHPDKKKHRGIVMEKEEYFTCITKAYEQVGMSD 160

  Fly    95 SRREKYDRV---LKEGMPNWKSALY--YYRRMRKIGLYEGAFI-LFLITTVGQ-----------Y 142
            .:|:.:|.|   ..:.:||.||..:  :|..:..:......:. :..:..:|:           |
 Worm   161 VKRQAFDSVDHKFNDIIPNEKSINHNNFYNELAPVFQLNSRWSNIKPVPELGKSDATREDVENFY 225

  Fly   143 LF-----AWA--AYL--EKKYTAEQVFGTKLKKLQKKNKNIDMDVILSEIPMPSLLNTLPIQIPL 198
            .|     :|.  :||  |.|...|..:  :.::::|:||      ...|.........:...:.:
 Worm   226 DFWFNFQSWREFSYLDEEDKERGEDRY--ERREMEKQNK------AERERRRKEEAKRIRKLVDI 282

  Fly   199 ALWNLPRTIKNGF--------SKANELKELAL---------EKRRQELEAVRRQEELEREAEEQA 246
            |....||.||  |        .||.|.|:.|:         |||.:|....:::||.:|:|:|:.
 Worm   283 AYAKDPRIIK--FKKEQQAKKDKAKEDKQRAIREKQEAIDREKREKEEAEAKQKEEADRKAKEER 345

  Fly   247 RLRKEHKENLRK-----RKQNSKAPEK-------------------------TEEELRGY----- 276
            ...|:.::..:|     ||:..|..::                         |.::||..     
 Worm   346 EREKKERDIAKKAMSQQRKRLKKLADEAGHWTENPRDKLTEMERIERICIGFTVDQLRELCEKVE 410

  Fly   277 -----SQIQTRELTDDDAVR--PASQKSTVSGG------------FWTDEDLTELIRLVKKYPGG 322
                 |:||| .|||.:.::  .|..|.|::..            .||.|::..|::....:|.|
 Worm   411 SLSIASEIQT-ALTDAEILKKEAAGAKVTITEDKNKENEKQADKETWTSEEIQLLVKASNTFPPG 474

  Fly   323 AGSRWNTIAESMNRSVQEVTFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKE-KVKKAAANA 386
            ...||..||:.:|...::.|           .:|.:|:   :.::::.:..|... |:.....|.
 Worm   475 TVERWVQIADYINEHRKDST-----------GLPPKTE---KQVIKQCKAVQTMNVKLPSTTQNQ 525

  Fly   387 GASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELV 451
            ..:|    |..|..|:..:|:.||.||.|: |::..:||:||:..|..|:|:.|:.|:|||.::|
 Worm   526 LGTA----LPDEDVWSATEQKTLEDAIKKH-KSSDPERWEKISTEVGTKSKKACIRRFKYLVQMV 585

  Fly   452 KTQK 455
            |.:|
 Worm   586 KNKK 589

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 15/69 (22%)
SANT 301..>341 CDD:197842 11/52 (21%)
SANT 304..341 CDD:238096 11/37 (30%)
SANT 399..447 CDD:197842 19/48 (40%)
SANT 400..447 CDD:238096 19/47 (40%)
dnj-11NP_501006.1 ZUO1 61..441 CDD:227594 74/356 (21%)
DnaJ 98..167 CDD:278647 15/69 (22%)
SANT 455..509 CDD:238096 14/68 (21%)
SANT 536..584 CDD:197842 20/49 (41%)
SANT 536..582 CDD:238096 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.