DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and F54F2.9

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_498949.2 Gene:F54F2.9 WormBaseID:WBGene00018836 Length:414 Species:Caenorhabditis elegans

Alignment Length:467 Identity:160/468 (34%)
Similarity:241/468 (51%) Gaps:71/468 (15%)


  Fly     3 MRPELTLAGLLLL--CATGASAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSI 65
            ||..|.||.|:.|  |     .|.||:|.::||||||..||||:..|.:.|:..:||:|:|.|::
 Worm     1 MRVILLLAFLISLTEC-----QWTSEDLALYDLVEEVGVNFYEWFDIPRDASSNQVKKAYRKLTL 60

  Fly    66 VLHPDKNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGA 130
            ..|||:|.|.||..:||.:..||||||....|||||.||:.|:|:|:..:||||||||:..|||.
 Worm    61 EWHPDRNSAPDATEKFRQVAGIYEVLKTTELREKYDNVLENGLPSWRHPMYYYRRMRKLAWYEGI 125

  Fly   131 FILFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLKKLQKKNKNIDMDVILS---EIPMPSLLNTL 192
            .:|..|.|:..||..||||.||....:|  ..|..:..||....:.:.::.   |..:|.....|
 Worm   126 LVLLFIGTIAHYLMMWAAYFEKTLVYKQ--NVKKSRKSKKEDPAEAEKLMKQALEEYLPKYSELL 188

  Fly   193 PIQI---PLALW-NLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHK 253
            ||.:   .:.|: ||..|.|:..:.    ||:..|:..:|..|.:|:::....|.:|...:.|..
 Worm   189 PIILARGTVTLFKNLALTAKDAMTP----KEVEPEEPTEEELAQQRRQQRAAAAPQQLEFKFEVA 249

  Fly   254 ENLRKRKQNSKAPEK---TEEELRGYSQIQTRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRL 315
            :.::....|....||   .|.|:                   .:||.  ||..||.::|..|:||
 Worm   250 QGMKAVSTNDPEMEKKYAAENEV-------------------VAQKQ--SGATWTPDELASLVRL 293

  Fly   316 -VKKYPGGAGSRWNTIAESMNRSVQEVTFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKEKV 379
             .:|||.|..:||..:...:|||.::|..||.|||:.      :.:...:.|:...||:...|  
 Worm   294 STEKYPAGTPNRWEQMGRVLNRSAEDVIAMAGKMKQM------KQEDYTKLLMTTIQQSVPVE-- 350

  Fly   380 KKAAANAGASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGD-RWQKIANSVPEKTKEECLVR 443
                       |||    |.:|:|.:|:|.|.|:.||.|  |.| ||::|:..:..|||::.:||
 Worm   351 -----------EKS----EDDWSQAEQKAFETALQKYPK--GTDERWERISEEIGSKTKKQVMVR 398

  Fly   444 YKYLCELVKTQK 455
            :|.|.|:::.:|
 Worm   399 FKQLAEMIRKKK 410

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 30/61 (49%)
SANT 301..>341 CDD:197842 16/41 (39%)
SANT 304..341 CDD:238096 15/38 (39%)
SANT 399..447 CDD:197842 20/49 (41%)
SANT 400..447 CDD:238096 20/48 (42%)
F54F2.9NP_498949.2 DnaJ 35..96 CDD:278647 30/61 (49%)
SANT 357..402 CDD:238096 20/47 (43%)
SANT 357..402 CDD:197842 20/47 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 235 1.000 Inparanoid score I2127
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D412930at33208
OrthoFinder 1 1.000 FOG0004035
OrthoInspector 1 1.000 T475970
orthoMCL 1 0.900 OOG5_133220
Panther 1 1.100 LDO PTHR44653
Phylome 1 0.910 0.905 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1934
TreeFam 1 0.960
1211.870

Return to query results.
Submit another query.