DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Mllt10

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_006497434.2 Gene:Mllt10 MGIID:1329038 Length:1124 Species:Mus musculus

Alignment Length:216 Identity:45/217 (21%)
Similarity:76/217 (35%) Gaps:54/217 (25%)


  Fly   208 KNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKENLRK---RKQN---SKAP 266
            |..|||..:.|..:.....|.|.......:.:...:|:.:..|:|::.||:   ||:|   .|..
Mouse   195 KYHFSKLKKSKRGSNRSYEQSLSDSSSHSQDKHHEKEKKKEEKKHEDELRRIWSRKKNRSMRKYK 259

  Fly   267 EKTEEELRGYSQ-------IQTRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKYPGGAG 324
            ||.:.:.:...|       :.:..:|.:......|..| :||.....||                
Mouse   260 EKDKHKQKHKKQPEPSPALVPSLTVTTEKTYTSTSNNS-ISGSLKRLED---------------- 307

  Fly   325 SRWNTIAESMNRSVQEVTFMAAKMKENGYRIPGQTDSVAEALVQESQ--------QAQRKEKVKK 381
                |.|...|.:.|||:...:..|:           |:||...|.:        ..||..| ..
Mouse   308 ----TAARFTNANFQEVSAHTSSGKD-----------VSEARGSEGKGKKSSAHSSGQRGRK-PG 356

  Fly   382 AAANAGASAEKSMLIPETNWT 402
            |..|.|.:...|...|:.:::
Mouse   357 AGRNPGTAVSASSPFPQGSFS 377

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647
SANT 301..>341 CDD:197842 8/40 (20%)
SANT 304..341 CDD:238096 7/37 (19%)
SANT 399..447 CDD:197842 0/5 (0%)
SANT 400..447 CDD:238096 0/4 (0%)
Mllt10XP_006497434.2 PHD_AF10_AF17 24..71 CDD:277049
RanBP2-type Zn finger 66..85 CDD:275375
ePHD_AF10 78..206 CDD:277178 5/11 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.