DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and dnj-28

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_491084.1 Gene:dnj-28 WormBaseID:WBGene00001046 Length:494 Species:Caenorhabditis elegans

Alignment Length:67 Identity:17/68 (25%)
Similarity:37/68 (54%) Gaps:4/68 (6%)


  Fly    39 RNFYEFMGINQTATGAEVKRAFRTLSIVLHP----DKNPAEDANIQFRNLVSIYEVLKDPSRREK 99
            |::|:.:|:.:.|...|:.:|:|.::...||    |:...:.|..:|.::.:..|||.:..:|..
 Worm   379 RDYYKILGVRRNANKREITKAYRKMAQKWHPDNFQDEKEKKKAEKKFIDIAAAKEVLSNEEKRRA 443

  Fly   100 YD 101
            :|
 Worm   444 FD 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 15/65 (23%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
dnj-28NP_491084.1 TPR_11 23..89 CDD:290150
TPR repeat 28..52 CDD:276809
TPR_1 <31..56 CDD:278916
TPR repeat 57..87 CDD:276809
TPR_9 78..136 CDD:290108
TPR repeat 92..116 CDD:276809
TPR_11 174..240 CDD:290150
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 291..321 CDD:276809
TPR_11 294..356 CDD:290150
TPR repeat 326..352 CDD:276809
DnaJ 378..>445 CDD:223560 16/66 (24%)
DnaJ 380..445 CDD:278647 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C114679471
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.