DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Dnajc1

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001177746.1 Gene:Dnajc1 MGIID:103268 Length:552 Species:Mus musculus

Alignment Length:573 Identity:186/574 (32%)
Similarity:272/574 (47%) Gaps:162/574 (28%)


  Fly     3 MRPELTLAGLLLLCATGASAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVL 67
            :||...|...||.......||.|.:||:|||||||..|||||:|:.|.|:.|::::|:|.||:.|
Mouse    24 VRPLWLLLLFLLAAVRPVRAWESGDLELFDLVEEVQLNFYEFLGVQQDASSADIRKAYRKLSLTL 88

  Fly    68 HPDKNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFI 132
            |||||..|:|..|||.||:|||||||..||::||.||..|:|:|:..::||||:||:...|.|.:
Mouse    89 HPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDVLINGLPDWRQPVFYYRRVRKMSNAELALL 153

  Fly   133 LFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLKKLQKK--NKNIDMDVI-LSE-----IPMPSLL 189
            ||:|.|||.|...|:.||||:  .:::.|.|.::.:||  :|::|...: .||     :..|...
Mouse   154 LFIILTVGHYAVVWSIYLEKQ--LDELLGRKKRERKKKTGSKSVDAAKLGASEKNERLLIKPQWH 216

  Fly   190 NTLPIQIPLALW------NLPRTIKNGFSKANELKELALEKR-----RQELEAVRRQEELE---- 239
            :.||.:  |.:|      .||..|::......:.||..|:::     |.|:|.:::|::::    
Mouse   217 DLLPCK--LGIWFCLTLKALPHLIQDAGQFYAKYKETKLKEKEDALARIEIETLQKQKKVKVKKP 279

  Fly   240 ------------------------REAEEQARLRKEHKENLRKRKQNSKAPEKTEEELRGYSQIQ 280
                                    .|.|||   ..:..|| |||.|..:|||             
Mouse   280 KPEFPVYMPLENTYIQSYDHGTSIEEIEEQ---MDDWLEN-RKRTQKRQAPE------------- 327

  Fly   281 TRELTDDDAVRPASQKSTVSGGFWTDEDLTELIRLVKKYPGGAGSRWNTIAESMNRSVQEVTFMA 345
                                   ||:|||::|.|.:.|:|||...||:.||..:.|||.:||..|
Mouse   328 -----------------------WTEEDLSQLTRSMVKFPGGTPGRWDKIAHELGRSVTDVTTKA 369

  Fly   346 AKMKENGYRIPGQTD--------------SVAEAL-------------------------VQESQ 371
            .::|::....||.|.              .:|.||                         .|||.
Mouse   370 KELKDSVTSSPGMTRLSELKSNGQNSRPIKIATALPDDIITQREDSAGAMEDEEHEAAEGEQESA 434

  Fly   372 QAQRKEKVKKAAANAGA------------SAEKSMLIPETN-------------------WTQEQ 405
            ..:.:.:.:|:|..|.|            ..:|...|.|.|                   |||.|
Mouse   435 TTEARPRRRKSARAAEAVTRVEPEEKLRGKRQKDFDISEQNDSSDEEKQRKERTRAAEEAWTQSQ 499

  Fly   406 QRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAE 458
            |:.||.|:.:|.|.| .|||.|||..||.|:||:|:.|||.|.|||:.:|:|:
Mouse   500 QKLLELALQQYPKGA-SDRWDKIAKCVPSKSKEDCIARYKLLVELVQKKKQAK 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 36/61 (59%)
SANT 301..>341 CDD:197842 18/40 (45%)
SANT 304..341 CDD:238096 18/37 (49%)
SANT 399..447 CDD:197842 27/67 (40%)
SANT 400..447 CDD:238096 27/66 (41%)
Dnajc1NP_001177746.1 DnaJ 61..122 CDD:278647 36/61 (59%)
SANT 327..373 CDD:238096 22/82 (27%)
SANT 493..542 CDD:197842 27/50 (54%)
SANT 494..541 CDD:238096 27/48 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355748068
eggNOG 1 0.900 E1_KOG0724
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 251 1.000 Inparanoid score I3187
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004035
OrthoInspector 1 1.000 T1085150
orthoMCL 1 0.900 OOG5_133220
Panther 1 1.100 LDO PTHR44653
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1934
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.