DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Dnajc2

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_446228.2 Gene:Dnajc2 RGDID:620524 Length:621 Species:Rattus norvegicus

Alignment Length:566 Identity:138/567 (24%)
Similarity:230/567 (41%) Gaps:154/567 (27%)


  Fly    27 ELEIFDLVEEV------NRNFYEFMGINQT---ATGAEVKRAFRTLSIVLHPDKNPA------ED 76
            :||.|.:::.:      |::.|..:|:...   ||..::|.|.:|:.:..||||..|      |.
  Rat    69 QLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKTMVLKHHPDKRKAAGEPIKEG 133

  Fly    77 ANIQFRNLVSIYEVLKDPSRREKY---DRVLKEGMPNWKSALYYY-----------------RRM 121
            .|..|..:...||:|.||.:|..:   |......:|:...|...:                 :.:
  Rat   134 DNDYFTCITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKENFFQVFSPVFERNSRWSNKKNV 198

  Fly   122 RKIGLYEGAFILFLITTVGQYLFAW--------AAYLEKKYTAEQVFGTKLKKLQKKNKNIDMDV 178
            .|:|....:|     ..|..:...|        .:||:::...:.....:.|.::|:|:......
  Rat   199 PKLGDMNSSF-----EDVDAFYSFWYNFDSWREFSYLDEEEKEKAECRDERKWIEKQNRATRAQR 258

  Fly   179 ILSEIPMPSLLNTLPIQIPLALWNLPR-------------TIKNGFSKANELKELALEKRRQ-EL 229
            ...|      :|.:...:..|....||             ..|...::|...::.|.||:|| ||
  Rat   259 KKEE------MNRIRTLVDNAYSCDPRIKKFKEEGKAKKEAEKRAKAEARRKEQEAKEKQRQAEL 317

  Fly   230 EAVR-RQEELEREAEEQARLRKEHKENLRK--RKQNSK--------------------------- 264
            |||| .:|:.|.|..:||.|.|:.||..:|  :|:..|                           
  Rat   318 EAVRLAKEKEEEEVRQQALLAKKEKEIQKKAIKKERQKLRNSCKNWNHFSDNEADRVKMMEEVEK 382

  Fly   265 ---------------------------APEKTEEELRGYSQIQTRELTDDDA-VRPAS---QKST 298
                                       |.||..||:   :::..:|..:.|| :|.||   :|||
  Rat   383 LCDRLELASLQCLNEILASSTREVGKAALEKQIEEV---NELMRKEKEEADARMRQASKNAEKST 444

  Fly   299 VSGGF----WTDEDLTELIRLVKKYPGGAGSRWNTIAESMN--------RSVQEVTFMAAKMKEN 351
            ...|.    |:::||..||:.|..:|.|..|||..||..||        |:.::|...|..:::.
  Rat   445 GRSGSGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKL 509

  Fly   352 GYRIPGQTDSVAEALVQESQQAQRKEKVKKAAANAGASAEK--SMLIPETNWTQEQQRALEAAIV 414
            .   |.|.|.:.:....:.    :||......|::.|.:|:  ...|....||.|:|:.||.|:.
  Rat   510 D---PHQKDDINKKAFDKF----KKEHGVAPQADSAAPSERFEGPCIDSIPWTTEEQKLLEQALK 567

  Fly   415 KYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRAEEE 460
            .|.... .:||:|||.:||.:||::|:.|||.|.|:||.:|.|:|:
  Rat   568 TYPVNT-PERWEKIAEAVPGRTKKDCMRRYKELVEMVKAKKAAQEQ 612

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 21/73 (29%)
SANT 301..>341 CDD:197842 17/52 (33%)
SANT 304..341 CDD:238096 16/45 (36%)
SANT 399..447 CDD:197842 21/48 (44%)
SANT 400..447 CDD:238096 21/47 (45%)
Dnajc2NP_446228.2 DnaJ 88..158 CDD:278647 21/70 (30%)
ZRF1-UBD 160..250 12/95 (13%)
GBP_C <288..353 CDD:303769 24/65 (37%)
RAC_head 349..420 CDD:293322 7/74 (9%)
SANT 452..508 CDD:197842 18/56 (32%)
SANT 453..506 CDD:238096 18/53 (34%)
SANT 553..602 CDD:197842 23/50 (46%)
SANT 553..600 CDD:238096 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.