DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG7556 and Dnajc1

Sequence 1:NP_001285427.1 Gene:CG7556 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_002728560.1 Gene:Dnajc1 RGDID:2322144 Length:565 Species:Rattus norvegicus

Alignment Length:548 Identity:183/549 (33%)
Similarity:269/549 (49%) Gaps:110/549 (20%)


  Fly     3 MRPELTLAGLLLLCATGASAWHSEELEIFDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVL 67
            |||...|...||:......||.|.:||:|||||||..|||||:|:.|.|:.|::::|:|.||:.|
  Rat    35 MRPLWPLLLFLLVAVRPVRAWESGDLELFDLVEEVQLNFYEFLGVQQDASSADIRKAYRKLSLTL 99

  Fly    68 HPDKNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFI 132
            |||||..|:|..|||.||:|||||||..||::||.:|..|:|:|:..::||||:||:...|.|.:
  Rat   100 HPDKNKDENAETQFRQLVAIYEVLKDDERRQRYDDILINGLPDWRQPVFYYRRVRKMSNAELALL 164

  Fly   133 LFLITTVGQYLFAWAAYLEKKYTAEQVFGTKLKKLQKKNKNIDMDVI---LSE-----IPMPSLL 189
            ||:|.|||.|...|:.||||:  .:::...|.::.::|..:..:|..   .||     :..|...
  Rat   165 LFIILTVGHYAVVWSIYLEKQ--LDELLSRKKREKKRKTGSKSVDAAKPGASERNERLLIKPQWH 227

  Fly   190 NTLPIQIPLALW------NLPRTIKNGFSKANELKELALEKRRQELEAVRRQEELEREAEEQARL 248
            :.||.:  |.:|      .||..|::......:.||..|:::...|..|    |||       .|
  Rat   228 DLLPCK--LGIWFCLTLKALPHLIQDAGQFYAKYKETKLKEKEDALARV----ELE-------TL 279

  Fly   249 RKEHKENLRKRKQNSKAPEKTEEE---LRGY---SQIQTRELTDDDAVRPASQKSTVSGGFWTDE 307
            .|:.|..::|.|  .:.|..|..|   ::.|   :.|:..|...||.:...::........||:|
  Rat   280 HKQKKAKVKKPK--PEFPVYTPLENTYIQSYDHGTSIEEIEEQMDDWLENRNRTQKKQAPEWTEE 342

  Fly   308 DLTELIRLVKKYPGGAGSRWNTIAESMNRSVQEVTFMAAKMKENGYRIPGQTD------------ 360
            ||::|.|.:.|:|||...||..||..:.|||.:||..|.::|::....||.|.            
  Rat   343 DLSQLTRSMVKFPGGTPGRWEKIAHELGRSVTDVTTKAKELKDSVTSSPGMTRLSELKSNVQNSR 407

  Fly   361 --SVAEAL--------------VQESQQAQ----------------RKEKVKKAA---------A 384
              .:|.||              ::|.::.|                |:.|..|.|         .
  Rat   408 PLKIATALPDDIITQREDSAGAIEEEEEEQETAEGDQETVTSEARPRRRKSAKVAEVVTRVEPEE 472

  Fly   385 NAGASAEKSMLIPETN-------------------WTQEQQRALEAAIVKYRKTAGGDRWQKIAN 430
            ......:|...|.|.|                   |||.||:.||.|:.:|.|.| .|||.|||.
  Rat   473 KLRGKRQKDFDISEQNDSSDEERPRKERSRAAEDAWTQSQQKLLELALQQYPKGA-SDRWDKIAK 536

  Fly   431 SVPEKTKEECLVRYKYLCELVKTQKRAE 458
            .||.|:||:|:.|||.|.|||:.:|:|:
  Rat   537 CVPSKSKEDCIARYKLLVELVQKKKQAK 564

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 36/61 (59%)
SANT 301..>341 CDD:197842 18/40 (45%)
SANT 304..341 CDD:238096 18/37 (49%)
SANT 399..447 CDD:197842 27/67 (40%)
SANT 400..447 CDD:238096 27/66 (41%)
Dnajc1XP_002728560.1 DnaJ 72..133 CDD:278647 36/61 (59%)
SANT 338..384 CDD:238096 21/46 (46%)
SANT 506..555 CDD:197842 27/50 (54%)
SANT 507..554 CDD:238096 27/48 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C355748188
eggNOG 1 0.900 E1_KOG0724
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 234 1.000 Inparanoid score I3276
OMA 1 1.010
OrthoDB 1 1.010 D412930at33208
OrthoFinder 1 1.000 FOG0004035
OrthoInspector 1 1.000 T1088697
orthoMCL 1 0.900 OOG5_133220
Panther 1 1.100 LDO PTHR44653
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.