DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD11B1 and CG31937

DIOPT Version :9

Sequence 1:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:116/267 - (43%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAFMKKYLLPILGLFMAYY-------------YYSANEEFRPEMLQGKKVIVTGASKGIGREMAY 52
            |:|: ::||.:|.|:...|             :|.:........::|:.|.:||||.||||.:|.
  Fly     1 MSFL-EFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALAL 64

Human    53 HLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLI 117
            .||:.|..:|::||..|.|::|...||    |:|..:..|.:.:...             :|||.
  Fly    65 SLARHGVKLVLSARRLEQLEQVQEECL----AAARGLLATKDVLVIQ-------------MDMLD 112

Human   118 LN-HIT--NTSLNLFHD-------------------DIHHVRKSMEVNFLSYVVLTVAALPMLKQ 160
            |: |.|  ||.||.||.                   :|...|:..|::..:.|.|:...:....:
  Fly   113 LDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVE 177

Human   161 SNGS---IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTET 222
            .||.   |...||:||....|....|.|:|.||:.:..|::.|..    .:.::|...|.|.|:.
  Fly   178 QNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMR----KLDVSLFAPGPIATDF 238

Human   223 AMKAVSG 229
            ..:|.:|
  Fly   239 LQEAFTG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 63/223 (28%)
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 63/223 (28%)
adh_short 47..245 CDD:278532 61/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D906746at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.