DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD11B1 and CG31937

DIOPT Version :9

Sequence 1:NP_005516.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens
Sequence 2:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster


Alignment Length:267 Identity:71/267 - (26%)
Similarity:116/267 - (43%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


Human     1 MAFMKKYLLPILGLFMAYY-------------YYSANEEFRPEMLQGKKVIVTGASKGIGREMAY 52
            |:|: ::||.:|.|:...|             :|.:........::|:.|.:||||.||||.:|.
  Fly     1 MSFL-EFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVWITGASSGIGRALAL 64

Human    53 HLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLI 117
            .||:.|..:|::||..|.|::|...||    |:|..:..|.:.:...             :|||.
  Fly    65 SLARHGVKLVLSARRLEQLEQVQEECL----AAARGLLATKDVLVIQ-------------MDMLD 112

Human   118 LN-HIT--NTSLNLFHD-------------------DIHHVRKSMEVNFLSYVVLTVAALPMLKQ 160
            |: |.|  ||.||.||.                   :|...|:..|::..:.|.|:...:....:
  Fly   113 LDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVE 177

Human   161 SNGS---IVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTET 222
            .||.   |...||:||....|....|.|:|.||:.:..|::.|..    .:.::|...|.|.|:.
  Fly   178 QNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMR----KLDVSLFAPGPIATDF 238

Human   223 AMKAVSG 229
            ..:|.:|
  Fly   239 LQEAFTG 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD11B1NP_005516.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 63/223 (28%)
CG31937NP_608616.2 Rossmann-fold NAD(P)(+)-binding proteins 44..293 CDD:473865 63/223 (28%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - -
Hieranoid 00.000 Not matched by this tool.