DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and Mtpn

DIOPT Version :8

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_077350.1 Gene:Mtpn / 79215 RGDID:619806 Length:118 Species:Rattus norvegicus

Alignment Length:115 Identity:52/116 (45%)
Similarity:79/116 (68%) Gaps:2/116 (2%)


  Fly     8 EDIIWTIKNGVYDEVERIFLAGSLNVNDQM-GVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKY 71
            ::.:|.:|||..||| :.::|...:||..: |.|.|||||||.|||::|||.:..||:::..||:
  Rat     4 KEFMWALKNGDLDEV-KDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKH 67

  Fly    72 GITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLL 121
            .|||||:|::|||..||:.||..||.:|.:.|:|.:..||.:.:.|:.||
  Rat    68 HITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALL 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 43/87 (49%)
ANK 12..121 CDD:238125 51/110 (46%)
ANK repeat 37..69 CDD:293786 17/33 (52%)
ANK repeat 71..101 CDD:293786 16/30 (53%)
MtpnNP_077350.1 ANK 1 2..30 10/27 (37%)
Ank_2 6..97 CDD:338493 45/92 (49%)
ANK repeat 6..32 CDD:293786 10/27 (37%)
ANK 2 34..66 18/32 (56%)
ANK repeat 34..65 CDD:293786 17/31 (55%)
ANK 3 67..99 16/32 (50%)
ANK repeat 67..97 CDD:293786 16/30 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4214
Hieranoid 1 1.000
Homologene 1 1.000 H40607
Inparanoid 1 1.050 121 1.000 Inparanoid score I4592
OMA 1 1.010
OrthoDB 1 1.010 D1435166at2759
OrthoFinder 1 1.000 FOG0004837
OrthoInspector 1 1.000 T618332
orthoMCL 1 0.900 OOG5_134020
Panther 1 1.100 O PTHR24189
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1110.880

Return to query results.
Submit another query.