DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and CG31715

DIOPT Version :8

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_723568.1 Gene:CG31715 / 318909 FlyBaseID:FBgn0051715 Length:121 Species:Drosophila melanogaster

Alignment Length:115 Identity:71/116 (61%)
Similarity:94/116 (81%) Gaps:0/116 (0%)


  Fly     8 EDIIWTIKNGVYDEVERIFLAGSLNVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKYG 72
            ||||||||||.:|.|:..|...:..||:::..|||:|||||||||.:|||.:.:||:::||||:|
  Fly     7 EDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQLNVLEFLISLGADINRKDKHG 71

  Fly    73 ITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLLA 122
            |||:|||||||||.|||.||:|||.:...||:||||.||||:::|::|||
  Fly    72 ITPILAAIWEGHTSCVELLLKMGADKNGSTPDGQSYLEAAEKDEIKKLLA 121

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 54/86 (63%)
ANK 12..121 CDD:238125 65/109 (60%)
ANK repeat 37..69 CDD:293786 19/32 (59%)
ANK repeat 71..101 CDD:293786 21/30 (70%)
CG31715NP_723568.1 Ank_2 9..98 CDD:289560 55/89 (62%)
ANK repeat 9..36 CDD:293786 13/27 (48%)
ANK 11..120 CDD:238125 65/109 (60%)
ANK repeat 38..68 CDD:293786 19/30 (63%)
ANK repeat 70..98 CDD:293786 21/28 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C5090739
eggNOG 1 0.900 E2759_KOG4214
Homologene 1 1.000 H40607
Inparanoid 1 1.050 45 1.000 Inparanoid score I2603
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1435166at2759
OrthoFinder 1 1.000 FOG0004837
orthoMCL 1 0.900 OOG5_134020
Panther 1 1.100 P PTHR24189
RoundUp 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.