DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and Cdkn2b

DIOPT Version :8

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_017448639.1 Gene:Cdkn2b / 25164 RGDID:2324 Length:160 Species:Rattus norvegicus

Alignment Length:63 Identity:21/64 (33%)
Similarity:30/64 (47%) Gaps:1/64 (2%)


  Fly    23 ERIFLAGS-LNVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGH 84
            |.:.|.|: .|..|...:..|:|.||..|.|..|....:.||.:|..|.:|..|:..|..:||
  Rat    55 ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLMVLHKAGARLDVCDAWGRLPVDLAEEQGH 117

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 21/64 (33%)
ANK 12..121 CDD:238125 21/64 (33%)
ANK repeat 37..69 CDD:293786 10/32 (31%)
ANK repeat 71..101 CDD:293786 5/15 (33%)
Cdkn2bXP_017448639.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1435166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.