DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid4b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_919238.1 Gene:Arid4b MGIID:2137512 Length:1314 Species:Mus musculus

Alignment Length:1448 Identity:393/1449 (27%)
Similarity:592/1449 (41%) Gaps:365/1449 (25%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:.:|:||.|.|||:|||||:|||||||:....|.:||||.::....:..|.||.||.|   |:|
Mouse     1 MKALDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGP---LKV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            ||:|||::.| ....||.|.|:.|.|.|||||||||..||||::||||..|||.|||||||||||
Mouse    63 GAIVEVKNLD-GAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRRRGHLNED----SSEDDDESDAKEVVNEKEENIGKVVCVETESKKKD 189
            :|||||.||:|.:  ||||..|:.|:    ||.||||.:.|:.    :|.:||||||:..|.:|.
Mouse   127 NPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDDDEEERKQT----DELLGKVVCVDYVSLEKK 187

  Fly   190 KEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQA--- 251
            |..|||||||.|.....:.:: ||..||||||||::.:||:|:..|.|.:...|.|....||   
Mouse   188 KAMWFPALVVCPDCSDEIAVK-KDNILVRSFKDGKFTSVPRKDVHEITSDTVPKPDAVLKQAFDQ 251

  Fly   252 ALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPH----------------EEKDRF 300
            ||||..|..:||:|..:    |...||..|.|.:.:..|||..                ||::.|
Mouse   252 ALEFHKSRAIPANWKTE----LKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENF 312

  Fly   301 VAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVS 365
            :.||||:|:|||||:||.|.:..|:::|::|||.|.|.||::.:.|...||.:...||     :.
Mouse   313 LQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLG-----IP 372

  Fly   366 VMNL-----VKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASP-----KPME 420
            |:|.     ||.||||:|..:.::.|.......|                   |.|     ||.:
Mouse   373 VLNSAAGYNVKCAYKKYLYGFEEYCRSANIDFQM-------------------ALPEKVLNKPCK 418

  Fly   421 TMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPP 485
            ..:.:.: |:.:.::|.:                          .:...|:|.|...........
Mouse   419 DCENKEV-KVKEESETEI--------------------------KEVNVEDSKNVMPKEETPAED 456

  Fly   486 KKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSS 550
            :.:||.:...| .|..|||:|                           .:|..|           
Mouse   457 ESERKENIKPS-LGSKKSLLE---------------------------CIPAQS----------- 482

  Fly   551 ATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASA-SSKANSAEM 614
                            |.|.:..:.|              :|:..|:.......| :.:|.|.|:
Mouse   483 ----------------DEEKEAHITK--------------LEENENLEDKDGGRARTEEAFSTEV 517

  Fly   615 QRSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEK 679
            ....:.:.|       |..|:            ||:.:..::.::|:::|:||.:........|:
Mouse   518 DGEEEQARS-------GDETN------------KEEDEDDEEIEEEEEEDEEEDEDEDDDDNNEE 563

  Fly   680 ISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDE 744
            ...|....       |.|::|.|...|:.    ..|||.:.:..|:.|..:|||||.|||.||||
Mouse   564 EEFECYPP-------GMKVQVRYGRGKNQ----KMYEASIKDSDVEGGEALYLVHYCGWNVRYDE 617

  Fly   745 WVPRERIAENLTKG--------------SKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGS 795
            |:..::|.....|.              .|:|.|....|..|                      .
Mouse   618 WIKADKIVRPADKNVPKIKHRKKIKNKLDKEKDRDEKYSPKN----------------------C 660

  Fly   796 LLVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTG-- 858
            .|.:.|:.|..|:  |..:..||:..:...:               |.|..:.|..:.:...|  
Mouse   661 KLRRLSKSPFQSN--PSPEMVSKLDLADAKN---------------SDTAHIKSIEITSILNGLQ 708

  Fly   859 GAKRGRGRSDSMPPRST-------TPSSVVAHSGRTKSPAASQ-----PQLQQQMKKRPTRVVPG 911
            .::.....|:....|.|       ...|.|.||..:::...|:     |.|.::.|.....|:..
Mouse   709 ASESSAEDSEQEDERCTQDVDNIGKDESKVEHSTHSRNELISKEEQSSPSLLEENKVHTDLVIAK 773

  Fly   912 TT--TPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGKAQPP----GKGRLASS------- 963
            |.  :|.|:.....|...|:|.:|.....|::....|....||..|    ||.|..|:       
Mouse   774 TVSKSPERLRKDMEAISEDTDFEEEDEITKKRKDVKKDTTDKALKPQTKRGKRRYCSADECLQTG 838

  Fly   964 --------ASSTAP-AAHPSDDSEEDEEEEEPSAARAASSKQQ---QQQASSLRG-------SRA 1009
                    ..|..| ....|.:|..||:|||.|.|:...:|:.   :::..|||.       |..
Mouse   839 SPGKKEDRTKSKEPLCTENSSNSSSDEDEEEKSKAKMTPTKKYNGLEEKRKSLRTTSFYSGFSEV 903

  Fly  1010 GGNRAM---SSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIK 1071
            ...|..   :|.......|..|..::.|.::|..||.......::...:.|...|  .||..:..
Mouse   904 AEKRIKLLNNSDERLQNNRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPP--HPAPDEGA 966

  Fly  1072 KEPKLESSAKSSS----TEL------SSETESYADEDSQSSDYRKQLKGSGAG---KKEPTA--S 1121
            .|..|::.|:..|    .||      |.:.:...::..:.||.:.:...||:.   ...||.  |
Mouse   967 VEESLQTVAEEESCSPIMELEKPLPASVDNKPIEEKPLEVSDRKTEFPSSGSNSVLNTPPTTPES 1031

  Fly  1122 PSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPAR----FGNTS- 1181
            ||.     ||..|.:.::..:.:.....|.:||.:|....:.:.|:..:::...:    .||:| 
Mouse  1032 PSS-----VTITEASQQQSSVTVSVPLPPNQEEVRSIKSETDSTIEVDSVVGELQDLQSEGNSSP 1091

  Fly  1182 AAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQE 1246
            |...||.|.|||...:..:  .||..|  |:|.|            |.:.|.|    |||...:.
Mouse  1092 AGFDASVSSSSSNQPEPDN--PEKACT--GQKRV------------KDTQGVG----SSSKKQKR 1136

  Fly  1247 SKKFAEPVASLKVEMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATP 1311
            |.| |..|.:.|       ....::||.|...|.|.:|:.:...:|:|...|...|.......:|
Mouse  1137 SHK-ATVVNNKK-------KGKGTNSSDSEELSAGESVTKTQTIKSVPTGMKTHNSKSPARVQSP 1193

  Fly  1312 GAAA---------LQPSN 1320
            |...         .:|||
Mouse  1194 GKGGRNGDKDPDLKEPSN 1211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 42/94 (45%)
ARID 299..381 CDD:279697 37/87 (43%)
Tudor-knot 692..751 CDD:288553 23/59 (39%)
Arid4bNP_919238.1 TUDOR 58..113 CDD:197660 33/59 (56%)
RBB1NT 169..262 CDD:285392 42/98 (43%)
ARID 311..394 CDD:198082 37/88 (42%)
Tudor-knot 571..624 CDD:288553 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104861809
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 423 1.000 Inparanoid score I1746
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T616969
orthoMCL 1 0.900 OOG5_131238
Panther 1 1.100 O PTHR13964
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
1110.780

Return to query results.
Submit another query.