DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and SWI1

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_015309.1 Gene:SWI1 SGDID:S000005937 Length:1314 Species:Saccharomyces cerevisiae

Alignment Length:661 Identity:109/662 (16%)
Similarity:202/662 (31%) Gaps:254/662 (38%)


  Fly   118 FNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNE------DSSEDDDESDAKEVVNEKEENIG 176
            ||.|.: :...||..:...|........|.....||      |::.:.:..:.:...|.|..|..
Yeast   239 FNNSAS-NNGNLTSNQLISNYAASNSMDRSSSASNEFVPNTSDNNNNSNNHNMRNNSNNKTSNNN 302

  Fly   177 KVVCVETESKKKDKEKWFPALVVAPTAQAT--------------VRIRVKDEYLVRSFKDGRYYT 227
            .|..|             ||...|.|..:|              ..::.|.:...::.:..:...
Yeast   303 NVTAV-------------PAATPANTNNSTSNANTVFSERAAMFAALQQKQQQRFQALQQQQQQQ 354

  Fly   228 VPKKEATEFTREVASKQDVPAVQAALEFLDS-----------SVLPAHWDRDSLFGLTNISSDDE 281
            ..:::..:..::...:|..|      :||.|           |:.||                  
Yeast   355 QNQQQQNQQPQQQQQQQQNP------KFLQSQRQQQQRSILQSLNPA------------------ 395

  Fly   282 GEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTS 346
              :....|.:..:::.:.|:..|.:....|..||..:|.|.:|.::|:.|:..|||.||.::||.
Yeast   396 --LQEKISTELNNKQYELFMKSLIENCKKRNMPLQSIPEIGNRKINLFYLYMLVQKFGGADQVTR 458

  Fly   347 QNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRAN 411
            ..||.::|.||     .:|....::..|.:.|.||              .|:....:|....:|.
Yeast   459 TQQWSMVAQRL-----QISDYQQLESIYFRILLPY--------------ERHMISQEGIKETQAK 504

  Fly   412 SVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTS 476
            .:.    ::....|.:.|:.|..|...:|:.:::..:||                          
Yeast   505 RIF----LQQFLQELLKKVQQQQQAAALANANNNINSAS-------------------------- 539

  Fly   477 ESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAA 541
                                                      |:.|.|..|||..|.|.|.|.|.
Yeast   540 ------------------------------------------SAPTPAAPGASVPATAAPGTEAG 562

  Fly   542 ASTATNLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASAS 606
            .                             :|:         :|:|..|:....||:..::....
Yeast   563 I-----------------------------VPV---------SANTPKSLNSNININVNNNNIGQ 589

  Fly   607 SKANSAEMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQAS 671
            .:......||.:                            ||.|.:...:..:.:|..|.:::..
Yeast   590 QQVKKPRKQRVK----------------------------KKTKKELELERKEREDFQKRQQKLL 626

  Fly   672 SGKRKKEKISVEKIDTGDFVVGIGDKLKVNY--HEKKSPSSHGSTYEAKVIEISVQRGV-PMY-- 731
            ..:::::|:.:|            .||:..|  ..||.|         ||.:.|:.|.. |:.  
Yeast   627 EDQQRQQKLLLE------------TKLRQQYEIELKKLP---------KVYKRSIVRNYKPLINR 670

  Fly   732 LVHYTGWNNRY 742
            |.||.|::..|
Yeast   671 LKHYNGYDINY 681

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 16/116 (14%)
ARID 299..381 CDD:279697 26/82 (32%)
Tudor-knot 692..751 CDD:288553 16/57 (28%)
SWI1NP_015309.1 BRIGHT 407..492 CDD:128777 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T1136763
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13964
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.