DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and RSC9

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_013579.1 Gene:RSC9 SGDID:S000004596 Length:581 Species:Saccharomyces cerevisiae

Alignment Length:441 Identity:87/442 (20%)
Similarity:143/442 (32%) Gaps:121/442 (27%)


  Fly   105 LRRTALCLKSGRHFNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDDESDAKEVVN 169
            |.::::|        :|:.:|.|.:               |.....:..:.::|.|  ..:.:|.
Yeast   141 LNKSSIC--------DSKAMDSLQM---------------GLNALLILRNLAQDTD--SVQILVK 180

  Fly   170 EKEEN------IGKVVCVETESKK----KDKEKWFPALV-------------VAPTA------QA 205
            ::|..      :.|..||.|...|    :....:|..|.             :||..      |.
Yeast   181 DREIKSFILFILKKFQCVATGDNKWQLYEGNATFFNELTHYTLDLMEAISSYIAPAMKDDHYFQT 245

  Fly   206 TVRI--RVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQ-----------------DVPAVQA 251
            .|.|  ..||.|:|.|........:.:.:|.|   |.|:..                 |...:.|
Yeast   246 LVSILNYTKDRYMVISILRSLSRLLVRSKANE---ESAADNLDHKTLSLIVSFLLLECDSELIIA 307

  Fly   252 ALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDS----DSSDDEPH---EEKDRFVAQLYKYMD 309
            :|:||...:||.......||.....|...|..:.:    :.:..:.|   :.|.|.:.:|     
Yeast   308 SLDFLYQYILPGSQRITELFKSKECSLILEATLPNLLSYNIATPDYHLLQKHKIRLIKRL----- 367

  Fly   310 DRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTP---CTVSVMNLVK 371
              ..|..|.|..||.|     ||:.:.|   .|.......|    :|..|.|   ...:.::|.:
Yeast   368 --KPPAPKEPPNLSED-----LFQQLFK---LNEPLRSTAW----LRCCFEPVQEAEFTQISLWR 418

  Fly   372 QAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQP--N 434
            ....||.||..:..|||..::......||     :...|.::....|: |.|...:.|..||  .
Yeast   419 SYESKFGQPVRESGRKLLPAVEFIKNVSN-----AFNNAAAIVITDPV-TGKKRFVIKGIQPRFK 477

  Fly   435 QTNVVASTSSSAAAASVAASS--------TPARAVSTASQSAAEESGNTSE 477
            ...:......|....|...|.        ||||..|.......:|..:.|:
Yeast   478 ALGIADGERESQVPISALKSKFLNDSKEITPARQNSIPEVKFPQELSDVSK 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 28/139 (20%)
ARID 299..381 CDD:279697 21/85 (25%)
Tudor-knot 692..751 CDD:288553
RSC9NP_013579.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13964
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
22.130

Return to query results.
Submit another query.