DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid4b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_008769986.1 Gene:Arid4b RGDID:619919 Length:1319 Species:Rattus norvegicus

Alignment Length:1449 Identity:396/1450 (27%)
Similarity:605/1450 (42%) Gaps:367/1450 (25%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:.:|:||.|.|||:|||||:|||||||:....|.:||||.::....:..|.||.||.|   |:|
  Rat     1 MKALDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGP---LKV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            ||:|||::.| ....||.|.|:.|.|.|||||||||..||||::||||..|||.|||||||||||
  Rat    63 GAIVEVKNLD-GAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRRRGHLNED----SSEDDDESDAKEVVNEKEENIGKVVCVETESKKKD 189
            :|||||.||:|.:  ||||..|:.|:    ||.||||.|.|:.    :|.:||||||:..|..|.
  Rat   127 NPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDDDEDDRKQT----DELLGKVVCVDYISLDKK 187

  Fly   190 KEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQA--- 251
            |..|||||||.|.....:.:: ||..||||||||::.:||:|:..|.|.:.|.|.|....||   
  Rat   188 KALWFPALVVCPDCSDEIAVK-KDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFDQ 251

  Fly   252 ALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPH----------------EEKDRF 300
            ||||..|..:||:|..:    |...||..|.|.:.:..|||..                ||::.|
  Rat   252 ALEFHKSRTIPANWKTE----LKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENF 312

  Fly   301 VAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVS 365
            :.||||:|:|||||:||.|.:..|:::|::|||.|.|.||::.:.|...||.:...||     :.
  Rat   313 LQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLG-----IP 372

  Fly   366 VMNL-----VKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASP-----KPME 420
            |:|.     ||.||||:|..:.::.|.......|                   |.|     ||.:
  Rat   373 VLNSAAGYNVKCAYKKYLYGFEEYCRSANIDFQM-------------------ALPEKVLNKPCK 418

  Fly   421 TMKTETI----SKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVV 481
            ..:.:.|    ...|:..:.||..|.:      .:....|||.              :.||....
  Rat   419 DCENKEIKVKEESDAEIKEVNVEDSKN------MIPKEETPAE--------------DESERKEN 463

  Fly   482 VEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTAT 546
            ::|....:||            |:|                           .:|..|       
  Rat   464 IKPSLGSKKG------------LLE---------------------------CIPAQS------- 482

  Fly   547 NLSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANS 611
                                |.|.:..:.|::        .:.|:|.:...::.:..:.|::.::
  Rat   483 --------------------DQEKEANITKLE--------EKESLEDKDGATARAEEALSTEVDA 519

  Fly   612 AEMQ-RSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKR 675
            .|.| ||.|                         ...||:.:..::.::|:::|:||.:......
  Rat   520 EEEQARSGD-------------------------ETNKEEDEDDEEIEEEEEEDEEEDEDEDDDD 559

  Fly   676 KKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNN 740
            ..|:...|....       |.|::|.|...|:.    ..|||.:.:..|:.|..:|||||.|||.
  Rat   560 NNEEEEFECYPP-------GMKVQVRYGRGKNQ----KMYEASIKDSDVEGGEVLYLVHYCGWNV 613

  Fly   741 RYDEWVPRERIAENLTKG--------------SKQKTRTISTSSANSGSGGGGGGGGGGGGGGGG 791
            |||||:..::|.....|.              .|:|.|....|..|                   
  Rat   614 RYDEWIKADKIVRPADKNVPKIKHRKKIKNKLDKEKDRDEKYSPKN------------------- 659

  Fly   792 GGGSLLVQGSQPPGVSDKQPGKDGCSKMSPSSGNSTGPG---APSLSGSLGGASSTPSLLSTVVK 853
               ..|.:.|:.|..|:  |..:..||:..:...::..|   :..::..|.|..::.|       
  Rat   660 ---CKLRRLSKSPFQSN--PSPEMVSKLDLADAKNSDTGHIKSIEITSILNGLQASES------- 712

  Fly   854 TPPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQ-----PQLQQQMKKRPTRVVPGTT 913
              ....:::...|....|..|:...|.|.||..::|...|:     |.|.::.|..|..|:..|.
  Rat   713 --SAEDSEQEEERCAQDPESSSKDESKVEHSAHSRSELISKEELSSPSLLEENKVHPDLVIAKTV 775

  Fly   914 --TPRRV-SDASMASE-SDSDSDEPVRRPKRQSAKD------KPQA--GK---------AQPPGK 957
              :|.|: .|....|| :|.:.::.:.:.::...||      |||.  ||         .|....
  Rat   776 SKSPERLRKDVEAISEDTDFEEEDEITKKRKDVKKDTTDKALKPQTKRGKRRYCNTDECLQSGSP 840

  Fly   958 GRLASSASSTAP-AAHPSDDSEEDEEEEEPSAARAASSKQQ---QQQASSLRG-------SRAGG 1011
            |:......|..| ....|.:|..||:|||.|.|:...:|:.   :::..|||.       |....
  Rat   841 GKKEDRTKSKEPLCTGNSSNSSSDEDEEEKSKAKMTPTKKYNGLEEKRKSLRTTSFYSGFSEVAE 905

  Fly  1012 NRAM---SSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEP-------A 1066
            .|..   :|.......|..|..::.|.::|..||.......::...:.|...|...|       :
  Rat   906 KRIKLLNNSDERLQNNRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHAAPDEGTVEES 970

  Fly  1067 LQDIKKEPKLESSAKSSSTE----LSSETESYADEDSQSSDYRKQLKGSGAG---KKEPTA--SP 1122
            ||.:.:|   ||.:.:...|    .|.:::...::..:.||.:.:...||:.   ...||.  ||
  Rat   971 LQTVAEE---ESCSPNMELEKPLPTSVDSKPVEEKPLEVSDRKTEFPSSGSNSVLNTPPTTPESP 1032

  Fly  1123 SKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPAR----FGNTSAA 1183
            |.     ||..|.:.::..:.:.....|.:||.:|....:.:.|:..:::...:    .||:|.|
  Rat  1033 SS-----VTVTETSQQQSSVTVSVPLPPNQEEVRSIKSETDSTIEVDSVVGELQDLQSEGNSSPA 1092

  Fly  1184 ---QAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQ 1245
               .:.|||.|:....::.    ||..|  |:|.|            |.:.|.|    |||...:
  Rat  1093 GFNASVSSSSSNQPEPEHP----EKACT--GQKRV------------KDTQGVG----SSSKKQK 1135

  Fly  1246 ESKKFAEPVASLKVEMPAACSPSSSSSSSSSFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGAT 1310
            .|.| |..|.:.|       ....::||.|...|.|.:|:.:.|.:|:|...|...|.......:
  Rat  1136 RSHK-ATVVNNKK-------KGKGTNSSDSEDLSAGESVTKTQAIKSVPTGMKTHNSKSPARIQS 1192

  Fly  1311 PGAAA---------LQPSN 1320
            ||...         .:|||
  Rat  1193 PGKCGKNGDKDPDLKEPSN 1211

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 43/94 (46%)
ARID 299..381 CDD:279697 37/87 (43%)
Tudor-knot 692..751 CDD:288553 23/59 (39%)
Arid4bXP_008769986.1 TUDOR 58..113 CDD:197660 33/59 (56%)
RBB1NT 169..262 CDD:285392 43/98 (44%)
ARID 311..394 CDD:198082 37/88 (42%)
Tudor-knot 571..624 CDD:288553 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104862012
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4321
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T619080
orthoMCL 1 0.900 OOG5_131238
Panther 1 1.100 O PTHR13964
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.750

Return to query results.
Submit another query.