DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID5B

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_115575.1 Gene:ARID5B HGNCID:17362 Length:1188 Species:Homo sapiens

Alignment Length:1241 Identity:233/1242 (19%)
Similarity:390/1242 (31%) Gaps:421/1242 (34%)


  Fly   100 GDITTLRRT---ALCL---------KSGRHFNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLN 152
            ||...:|.|   .:|:         ::.|....|..|..||...|:           ||     |
Human    39 GDFFFVRCTPKDPICIAELQLLWEERTSRQLLSSSKLYFLPEDTPQ-----------GR-----N 87

  Fly   153 EDSSEDDDESDAKEVVNEKEE-------NIGKVVC------VETESKKKDKEKWFPALVVAPTAQ 204
            .|..||:..:.:::|:.:.|:       :..|..|      |:||:..::.:|  .||:....:.
Human    88 SDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHAGPVKTEALGRNGQK--EALLKYRQST 150

  Fly   205 ATVRIRVKD---------------EYLVRSFKD-GRYYTVPK----KEATEFTRE---------V 240
            ....:..||               ..:|.|:.. .||.::.|    |.::..|.:         |
Human   151 LNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQDKPSSILTDQFALALGGIAV 215

  Fly   241 ASKQDVPAVQAALEFLDSSVL----------------------PAHWDRDSLFGLTNISSDDEG- 282
            .|:.  |.:....:..|...|                      |....|||..|:.:.:::.:| 
Human   216 VSRN--PQILYCRDTFDHPTLIENESICDEFAPNLKGRPRKKKPCPQRRDSFSGVKDSNNNSDGK 278

  Fly   283 -----EIDSDSSDDEP----------HEEKDR-------------FVAQLYKYMDDRGTPLNKVP 319
                 :.::.|:..:|          :|||.:             |:..|||||.:|.||:.::|
Human   279 AVAKVKCEARSALTKPKNNHNCKKVSNEEKPKVAIGEECRADEQAFLVALYKYMKERKTPIERIP 343

  Fly   320 SILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDF 384
            .:..:.::|:.:|:|.||.|||..:|::.|||.|...||..|.:.|.....::.|::.:.||..|
Human   344 YLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERF 408

  Fly   385 HRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSS----- 444
                             .||.         ..||:..:|.......:|.|:.....|.:.     
Human   409 -----------------IKGE---------EDKPLPPIKPRKQENSSQENENKTKVSGTKRIKHE 447

  Fly   445 -SAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGKVKSLVEKY 508
             ..:......:..|..|...:|:...|:....|:.|:....|....|......|:...|.|..:.
Human   448 IPKSKKEKENAPKPQDAAEVSSEQEKEQETLISQKSIPEPLPAADMKKKIEGYQEFSAKPLASRV 512

  Fly   509 E-EKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIATTAMNKDAESDL 572
            : ||.......|:.......|.......|..||                                
Human   513 DPEKDNETDQGSNSEKVAEEAGEKGPTPPLPSA-------------------------------- 545

  Fly   573 PLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANS--AEMQRSRDASPSVAAPPSAGASTS 635
            |||..|.:|:...:::..:       :..||...||..|  .....|.::.|..|:.||...:..
Human   546 PLAPEKDSALVPGASKQPL-------TSPSALVDSKQESKLCCFTESPESEPQEASFPSFPTTQP 603

  Fly   636 GAAATAQTASNK--------------------KEKHQRSKQA---------DKEKDKDKEEKQAS 671
            ..|...:|..:|                    .:.|...||.         |..||||.      
Human   604 PLANQNETEDDKLPAMADYIANCTVKVDQLGSDDIHNALKQTPKVLVVQSFDMFKDKDL------ 662

  Fly   672 SGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYT 736
                           ||..                 ..:||..|    ..:...||.|       
Human   663 ---------------TGPM-----------------NENHGLNY----TPLLYSRGNP------- 684

  Fly   737 GWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGS 801
                         .|...|.|  |:....:|.:|.:|.                      ...||
Human   685 -------------GIMSPLAK--KKLLSQVSGASLSSS----------------------YPYGS 712

  Fly   802 QPPGVSDKQ--PGKDGCSKMSPS-SGNSTGPGA---PSLSGSLGGASSTPS----LLSTVVKTPP 856
            .||.:|.|:  ...|.||.:|.: .|.||...|   ||:...:....|.||    .::.:.|   
Human   713 PPPLISKKKLIARDDLCSSLSQTHHGQSTDHMAVSRPSVIQHVQSFRSKPSEERKTINDIFK--- 774

  Fly   857 TGGAKRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQM-----KKRPTRVVPGTTTPR 916
                .....|||  |.|       .:.|....:|.|....|:|::     |....|.:|.:..|.
Human   775 ----HEKLSRSD--PHR-------CSFSKHHLNPLADSYVLKQEIQEGKDKLLEKRALPHSHMPS 826

  Fly   917 RVSDASMAS-------------ESDSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRLASSA---- 964
            .::|...:.             .::..|..|.|...|:|......:.:.|........:|.    
Human   827 FLADFYSSPHLHSLYRHTEHHLHNEQTSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQD 891

  Fly   965 SSTAPAAHPSDDSEED----EEEEEPSA-----ARAASSKQQQQQASSLR--GSR---------- 1008
            ..:|.|..|:||...|    :...:|:.     |.:.:..|:.:..|..:  ||:          
Human   892 KKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTGPQESKGISQFQVLGSQSRDCHPKACR 956

  Fly  1009 ------AGGNRAMSSGAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPAL 1067
                  :|..:...|.:.|.|.....|...| :::|....:|..           |..|.:..|.
Human   957 VSPMTMSGPKKYPESLSRSGKPHHVRLENFR-KMEGMVHPILHR-----------KMSPQNIGAA 1009

  Fly  1068 QDIKKE----------------PKLESSAKSSSTELSSETESYADEDSQSSDYRKQLKGSGAGKK 1116
            :.||:.                ..|:.|.:.|..|.:||.||   |.|::: :.....|...|.|
Human  1010 RPIKRSLEDLDLVIAGKKARAVSPLDPSKEVSGKEKASEQES---EGSKAA-HGGHSGGGSEGHK 1070

  Fly  1117 EPTASP 1122
            .|.:||
Human  1071 LPLSSP 1076

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 23/155 (15%)
ARID 299..381 CDD:279697 29/95 (31%)
Tudor-knot 692..751 CDD:288553 6/59 (10%)
ARID5BNP_115575.1 BAH 34..>108 CDD:295389 19/85 (22%)
BRIGHT 319..411 CDD:128777 32/109 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104463982
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.