DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htk and AT4G37280

DIOPT Version :9

Sequence 1:NP_573330.3 Gene:htk / 32877 FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_568021.1 Gene:AT4G37280 / 829882 AraportID:AT4G37280 Length:320 Species:Arabidopsis thaliana


Alignment Length:134 Identity:37/134 - (27%)
Similarity:52/134 - (38%) Gaps:48/134 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   673 GKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHG---------------STYEAKVIEI 722
            |...||    |....||...|           ..|||:.|               ..|.|||.::
plant     2 GSSSKE----ETASDGDTASG-----------GASPSNDGRLFSEGERVLAYHGPRVYGAKVQKV 51

  Fly   723 SVQRGVPMYLVHYTGWNNRYDEWVPRERI----AENLT------------KGSK--QKTRTISTS 769
            .:::....|.|||.|||..:||||..:|:    .|||.            ||:|  :..:|.:.|
plant    52 ELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENLVKQKALDKKQGVEKGTKSGRSAQTKTRS 116

  Fly   770 SANS 773
            ||::
plant   117 SADT 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 20/73 (27%)
AT4G37280NP_568021.1 Tudor-knot 31..82 CDD:288553 16/50 (32%)
MRG 135..299 CDD:283390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.