DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and AT4G37280

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_568021.1 Gene:AT4G37280 AraportID:AT4G37280 Length:320 Species:Arabidopsis thaliana

Alignment Length:137 Identity:37/138 (27%)
Similarity:51/138 (37%) Gaps:52/138 (38%)


  Fly   673 GKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSHG---------------STYEAKVIEI 722
            |...||    |....||...|           ..|||:.|               ..|.|||.::
plant     2 GSSSKE----ETASDGDTASG-----------GASPSNDGRLFSEGERVLAYHGPRVYGAKVQKV 51

  Fly   723 SVQRGVPMYLVHYTGWNNRYDEWVPRERI----AENLT------------KGSKQ------KTRT 765
            .:::....|.|||.|||..:||||..:|:    .|||.            ||:|.      |||:
plant    52 ELRKKEWKYFVHYLGWNKNWDEWVSADRLLKHTEENLVKQKALDKKQGVEKGTKSGRSAQTKTRS 116

  Fly   766 ISTSSAN 772
            .:.:.|:
plant   117 SADTKAD 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 21/74 (28%)
AT4G37280NP_568021.1 Tudor-knot 31..82 CDD:288553 16/51 (31%)
MRG 135..299 CDD:283390
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.