DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid2

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_780460.3 Gene:Arid2 MGIID:1924294 Length:1828 Species:Mus musculus

Alignment Length:2344 Identity:412/2345 (18%)
Similarity:683/2345 (29%) Gaps:877/2345 (37%)


  Fly   286 SDSSDDEPHEEKDR---FVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQ 347
            ::|:...|.:|:.:   |:.:|.::...||:|..|:|::..:::||:.|:..|...||:.:|:.:
Mouse     2 ANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEK 66

  Fly   348 NQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFH--------------------------- 385
            |||..|.....|.....:....:||.|.::|:.|...|                           
Mouse    67 NQWGEIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSY 131

  Fly   386 ------------RKLGCSMLMTSRNSNRSKGRSL-----------VRANSVASPKPMETMKTETI 427
                        :..|.||...|.|.......||           :...::.|.:....|:.|..
Mouse   132 NYQQHSVSDYLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKD 196

  Fly   428 SKLAQPNQTNVVASTSSSAAAASV-------------------AASSTPARAVSTASQSAAEESG 473
            .|:......|......:..:.:||                   .......|.:.:....|.|::.
Mouse   197 PKIITLLLANAGVFDDTLGSFSSVFGEEWREKTDRDFVKFWKDIVDDNEVRDLISDRNKAHEDTP 261

  Fly   474 NTSESSVVVEPPKK--------QRKGSAA------SSQQGKVKSLVEK--------YEEKSTAVQ 516
            .......:..||:|        ||....|      |.::..||.|...        ....|..:.
Mouse   262 GEWIWESLFHPPRKLGINDIEGQRVLQIAVILRNLSFEESNVKLLAANRTCLRFLLLSAHSHFIS 326

  Fly   517 ATSSGTVAGSGASASAAAMP----TTSAAASTAT-------------------NLSSATSGGSAT 558
            ....|.......:|.....|    ||.....|.|                   ||..|...|  .
Mouse   327 LRQLGLDTLGNIAAELLLDPVDFRTTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNG--V 389

  Fly   559 IATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPS 623
            :....:::|:..::.........:...||...:...|.:..    .|.:|.  |::::|.|.   
Mouse   390 LICEYVDQDSYREIICHLTLPDVLLVTSTLEVLYMLTEMGD----VACTKI--AKVEKSIDV--- 445

  Fly   624 VAAPPSAGASTSG--AAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKID 686
            :....|..|...|  |.|..:...:....||...:...:                    ::|::.
Mouse   446 LVCLVSMDAQMFGPDALAAVKLIEHPSSSHQVLSEIRPQ--------------------AIEQVQ 490

  Fly   687 TGDFVV-GIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVP--- 747
            |...:. |...:..|..|....|.         ::||..::       ....|.|.:.|..|   
Mouse   491 TQTHIASGPASRAVVAQHAAPPPG---------IVEIDSEK-------FACQWLNAHFEVNPDCS 539

  Fly   748 ---RERIAENLTKGSK-------------QKTRTI-----------STSSANSGSGGGGGGGGGG 785
               .|..:|.|:..||             :..||:           ||||               
Mouse   540 VSRAEMYSEYLSTCSKLARGGILTSTGFYKCLRTVFPNHTVKRVEDSTSS--------------- 589

  Fly   786 GGGGGGGGGSLLVQG--------------SQPPGVSDKQPGKDGCSKMSPSSGNSTGPGAPSLSG 836
                  |...:.|.|              .|.| :|......|..:.:||:...:..|..|..:|
Mouse   590 ------GQAHIHVIGVKRRALPLPIQMYYQQQP-ISTPVVRVDAVADLSPTPSPAGIPHGPQAAG 647

  Fly   837 SLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSVVAHS-GRTKSPAASQPQLQ-Q 899
                        :...:||.|..:........|.|.:.       .|: .:|.|.....|.:. .
Mouse   648 ------------NHFQRTPVTNQSSNLTATQMSFPVQG-------IHTVAQTVSRIPPNPSVHTH 693

  Fly   900 QMKKRPTRVVPG-TTTPRRVSDASMASESDSDSDEPVR-----RPKRQSAKDKPQAGKAQPPGKG 958
            |.:..|..|:.. ...|..|..|::...|...:..||.     .|.:.|......|| .||    
Mouse   694 QQQNSPVTVIQNKAPIPCEVVKATVIQNSVPQTAVPVSISVGGAPAQNSVGQNHSAG-PQP---- 753

  Fly   959 RLASSASSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAK 1023
              .:..:|.....|||                      ...|.|.|.....|             
Mouse   754 --VTVVNSQTLLHHPS----------------------VMPQPSPLHTVVPG------------- 781

  Fly  1024 GRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKSSSTELS 1088
                                               :.||..|.....:..|:.....:..|....
Mouse   782 -----------------------------------QVPSGTPVTVIQQTVPQSRMFGRVQSIPAC 811

  Fly  1089 SETESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEE 1153
            :.|.|                   .|::..|.||..:|                           
Mouse   812 TSTVS-------------------QGQQLITTSPQPMH--------------------------- 830

  Fly  1154 ETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVE-- 1216
             |.|:...:|:..:.|.:|||.::..|||:...     |:|:.:...|...:.:||.|..|.:  
Mouse   831 -TSSQQTAAGSQPQDTVIIAPPQYVTTSASNIV-----SATSVQNFQVATGQVVTIAGVPSPQPS 889

  Fly  1217 ----QHVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPV--ASLKVEMPAACSPSSSSSSSS 1275
                |::..|.  |..|.       .|.|...|..::..:|.  :.:.|..||            
Mouse   890 RVGFQNIAPKP--LPSQQ-------VSPSVVQQPIQQPQQPAQQSVVIVSQPA------------ 933

  Fly  1276 SFCSTGSAVSSSSATRSLPDMSKLEISSGTVPGATPGAAALQPSNVAQVSSSGAAKESKYSSSGG 1340
               ..|.|.:        |.:.::.:::   |.|.|....:|.:....::.|.:.          
Mouse   934 ---QQGQAYA--------PAIHQIVLAN---PAALPAGQTVQLTGQPNITPSSSP---------- 974

  Fly  1341 AAAGSGISMRKLLSSDVYEFKDTEPFEFEKRISPMASVGGTVAAAATAAGAMAAAGAASVITTMV 1405
                                            ||:......|..|.:::..:.:.|....::.|:
Mouse   975 --------------------------------SPVPPTNNQVPTAMSSSSTLQSQGPPPTVSQML 1007

  Fly  1406 PTPGASGSGVAASASTSAPVVVGSAARKQALKASAIQHILEHQSPAAGRERGGYGGMTSSISLLT 1470
                                   |..|:|.          :..||||                  
Mouse  1008 -----------------------SVKRQQQ----------QQHSPAA------------------ 1021

  Fly  1471 APKLKKRGSPLKEAALCMEKAKTYKLDKDQVQQPVEQKTQQLIQPTLGPVESYGAGSPEAMSNLS 1535
                     |.::..:             |||||  |:.|..:||. .|....|..:|...|.:.
Mouse  1022 ---------PAQQVQV-------------QVQQP--QQVQVQVQPQ-QPSAGVGQPAPNESSLIK 1061

  Fly  1536 T-------PTTSSGHAQLSASSTYSQLTPHHATPFDALRKSPSFNLNITALNEELAQTVQETTRA 1593
            .       |:|..|...|.|    .|:.|    |.:|...||.....: |.|:.....||     
Mouse  1062 QLLLPKRGPSTPGGKLILPA----PQIPP----PNNARAPSPQVVYQV-ANNQAAGFGVQ----- 1112

  Fly  1594 LTDALQPPSTPVPPTVSASGSTPTA--------VTPVITAMPTAGTAGLSCPSTPPTGANPVLAS 1650
                               |.||..        |..|.:|||.||..     .|.|.....:|..
Mouse  1113 -------------------GQTPAQQLLVGQQNVQLVQSAMPPAGGV-----QTVPISNLQILPG 1153

  Fly  1651 PKLSTPPQAI--NASKQPPASHIVGSPFIETRNVFELSTSNEGSGYSSGESKDNKFEKLENVKIL 1713
            |.:|..|..|  ..|.......:|.:....|..|                |:.|..:.:....:.
Mouse  1154 PLISNSPATIFQGTSGNQVTITVVPNTSFATATV----------------SQGNAAQLIAPAGLS 1202

  Fly  1714 LAGAVGPFDLD-----AGSYEQKTSSIADKVLKAISQKKEEVENNKGKPPVEPAAAAKTPGREDV 1773
            ::||.....|.     ||.....|:.:..|..|.|.||:||.:...|....|        .:.:|
Mouse  1203 MSGAQASAGLQVQTLPAGQSACTTAPLPFKGDKIICQKEEEAKEATGLHVHE--------RKIEV 1259

  Fly  1774 VPSPTAKLDLCSSAIKLDTLKLLSEPLKIQTGPLL-GELYRPGPATSSPETKSILESSLPAKNSE 1837
            :.:|:.:....::: ..||    ||. ::|.|.|| |..|.              :||||..||.
Mouse  1260 MENPSCRRGTTNTS-NGDT----SES-ELQVGSLLNGRKYS--------------DSSLPPSNSG 1304

  Fly  1838 --LSETIQKLECAIQQRKTPVGGALSLASSTAGTPPTAHTPNSTATAGAGFSDESMDSTDSE--- 1897
              .|||.|   |::      :....||.....|.|...::             |.:|..|.:   
Mouse  1305 KLQSETSQ---CSL------ISNGPSLELGENGAPGKQNS-------------EPVDMQDVKGDL 1347

  Fly  1898 QRLVIEDVIAEEHTTTTTTGEQKSPGSQQEEGQTNTATMATAVTAETEGTSSSTPTPPVPAPVKL 1962
            ::.::..:...:          |..||...:...|..      |:...|....:|..|       
Mouse  1348 KKALVNGICDFD----------KGDGSHLSKNIPNHK------TSNHVGNGEISPVEP------- 1389

  Fly  1963 ELGAKAMPGIQAPIPLKPAEGSSFAGKLTGVVQPPPLAKLQQQEELGQAQ----GQSKSISSFGI 2023
                               :|:|      |..| ...||..|.|.:....    |.|.|.||   
Mouse  1390 -------------------QGTS------GATQ-QDTAKGDQLERVSNGPVLTLGGSPSTSS--- 1425

  Fly  2024 PIVLPEIPASVVVATPALMVASAATVMRHSP-GSTPNSQAP-----VLISPKTFLTAPKVGEVGG 2082
               :.|.|:   ||||.|    :.|.:.:.| .|:.||..|     |::||.:  |||       
Mouse  1426 ---MQEAPS---VATPPL----SGTDLPNGPLASSLNSDVPQQRPSVVVSPHS--TAP------- 1471

  Fly  2083 LLLKAYTGVSGAVGAAPAGSVIASAGGGGTPTVISNFPQQQQQASVLQASSEMPANYVLDAEMAE 2147
             :::.:..::           :..:|...||:.:|:..:.....:..: :.:.||.         
Mouse  1472 -VIQGHQVIA-----------VPHSGPRVTPSALSSDARSTNGTAECK-TVKRPAE--------- 1514

  Fly  2148 PSNSSAPVVARPFVMHAVGKELFNVVAPAASSPLISDPHNESINLLCEETIPGSPAPNYGGTDQL 2212
             .|....|   |.:.:.||..:..          ||||:|..    |..|:...||    |.|  
Mouse  1515 -DNDRDTV---PGIPNKVGVRIVT----------ISDPNNAG----CSATMVAVPA----GAD-- 1555

  Fly  2213 PTAVNSALAIVGITPLPPDTPPPVPV-AAIQQQQQH---QLQSGQQQQAAKTGEVNPSGPNSSPD 2273
                             |.|...|.: :|.||:|||   .:||...|.       .|..|:.:..
Mouse  1556 -----------------PSTVAKVAIESAAQQKQQHPPTYMQSVAPQN-------TPMPPSPAVQ 1596

  Fly  2274 SASQDESGEEAKKNAGLEHEDSTGLGALNKRKRNRKPLPMSA----QTAAAV--AAQLQSLGK-- 2330
            ...|..|.:.:..:|..:|.|     .:.|..:|...|..|.    ||.:.|  .|..:..||  
Mouse  1597 VQGQPSSSQPSPVSASSQHAD-----PVRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDV 1656

  Fly  2331 -------------RRRQVSGMRNQKTTTTAAGSDTDDNSDNIAPNAGQQQQQPRQSARQHMMPQS 2382
                         :|::.|.:.:.:          |.:....|..||.:|.:|.|.|.|    :|
Mouse  1657 YPGQCLWEGCEPFQRQRFSFITHLQ----------DKHCSKDALLAGLKQDEPGQVANQ----KS 1707

  Fly  2383 NAQQ 2386
            :.:|
Mouse  1708 STKQ 1711

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697 23/85 (27%)
Tudor-knot 692..751 CDD:288553 11/66 (17%)
Arid2NP_780460.3 ARID 19..101 CDD:307514 24/82 (29%)
LXXLL. {ECO:0000250|UniProtKB:Q68CP9} 313..317 0/4 (0%)
RFX_DNA_binding 521..601 CDD:308073 18/108 (17%)
Atrophin-1 603..>910 CDD:331285 76/465 (16%)
Sec23_BS 1278..>1575 CDD:331630 97/468 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.