DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid4b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_004914677.1 Gene:arid4b XenbaseID:XB-GENE-1003570 Length:1267 Species:Xenopus tropicalis

Alignment Length:1518 Identity:369/1519 (24%)
Similarity:577/1519 (38%) Gaps:498/1519 (33%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:.:|:||.|.|||:|||||:|||||||:....|.:|||..::|...:..|.||.:|.|   |:|
 Frog    20 MKSLDEPPYLSVGTDVSAKYRGAFCEAKIKSTKRLVKVKATFRQDSSTVEVQDDHVKGP---LKV 81

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            |||||:|:|| ....||.|.|:.|.|.|||||||||..||||::||||..|||.:||||||||||
 Frog    82 GAVVEIRNPD-GTYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAQSETLDQLPLT 145

  Fly   131 HPEHFGNPVVGGR--RGRRRGHLNED----SSEDDDESDAKEVVNEKEENIGKVVCVETESKKKD 189
            :|||||.||:|.:  ||||...::|:    ||.|:||::.|    ..:|.||.||||:...||  
 Frog   146 NPEHFGTPVIGKKTSRGRRSNQIHEEESTSSSSDEDENECK----TSDELIGTVVCVDVGDKK-- 204

  Fly   190 KEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDV--PAVQAA 252
            |..|.|||||:|.....:.:: ||..||||||||::.:||:||..:. .::::|.|:  .|:..|
 Frog   205 KATWVPALVVSPDCCDDITVK-KDFILVRSFKDGKFASVPRKEIRDI-NDISTKNDIFKQALDQA 267

  Fly   253 LEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHE----------EKDRFVAQLYKY 307
            |||..:..:||:|..:.....::..::::.|.:.|:.||...|          |::.|:.||||:
 Frog   268 LEFCKTKTIPANWVTEVKEESSSSETEEDEEENKDNDDDNTSEEEEEIEPFPGERENFLQQLYKF 332

  Fly   308 MDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNL--- 369
            |:|||||:||.|.:..|:::|::|||.|.|.||:|.:.|...||.:...||     :.::|.   
 Frog   333 MEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFNNIDSGAIWKQVYQDLG-----IPILNSAAG 392

  Fly   370 --VKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQ 432
              ||.||:|:|..:.::     |    ||.|.                     :...|...|:| 
 Frog   393 YNVKCAYRKYLYGFEEY-----C----TSANI---------------------SFHMELPIKIA- 426

  Fly   433 PNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQ 497
                                             |...:|..:.::.||..|           |..
 Frog   427 ---------------------------------QKVCKEGVHENKVSVKQE-----------SES 447

  Fly   498 QGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIATT 562
            ||  :::.|:::.|...:                                               
 Frog   448 QG--ETVKEEFDTKHETI----------------------------------------------- 463

  Fly   563 AMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRS-------RDA 620
                  .:::.:.:||          ||..||   ..|....:.||....|...:       .:.
 Frog   464 ------NNEVNINEIK----------HSTVKE---FIGVHLCSESKVKEVEEHIAVNQETILEEI 509

  Fly   621 SPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKI 685
            :|.:                .:|....|||.:  .:..||::.|:.:...:..:...|....|..
 Frog   510 TPKI----------------EETIITDKEKTE--AEIKKEEELDENQHMETENEDSAEGEEFESY 556

  Fly   686 DTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPRER 750
            .:       |.|::|.|...|:.    ..|||.|.:..|:.|..:|||||.|||.|||||:..::
 Frog   557 PS-------GMKVQVRYGRGKNQ----KLYEASVKDSDVEGGEVLYLVHYCGWNVRYDEWIKADK 610

  Fly   751 IA--------------------ENLTKGSKQ--------------------KTRTISTSSANSGS 775
            |.                    |:..|..:.                    :..:|.....|..|
 Frog   611 IVRPADKSVPKIKHRKKIKNKLEHRDKSERDECSPKHCRLFPRPLFQPRDLENESIQDDPENKHS 675

  Fly   776 GGGGGGGGGGGGGGGGGGGSLLVQ------GSQPPGVSDKQPGKDGCS----------------- 817
                            ..|..:|:      |.|....|.:....|..|                 
 Frog   676 ----------------LQGHTMVEITSILNGLQAAENSAEDSETDHSSLNMDKEEKAFHMNHISY 724

  Fly   818 ---------KMSP-SSGNSTGPGAPSLSGSLGGASSTPSLLSTV-------------------VK 853
                     |..| :.||.||     |...|.....:|.||.||                   :|
 Frog   725 DINQRLDENKSFPLTEGNCTG-----LDPILAVIPRSPDLLKTVEDSSDDTDYEVESARQSKYLK 784

  Fly   854 TPPTGGA-KRGRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRR 917
            ...|... |||:.:...|              |:.:||..::...:            ...|..|
 Frog   785 NDITKSQNKRGKRKYTEM--------------GKARSPNGNEVYSK------------CNETTDR 823

  Fly   918 VSDASMASESDSDSDEPVR---------RPKRQSAKDKPQAGKAQPPGKG-RLASSAS------- 965
            :...||.|..|.:...|..         ..||:|.:.....|.::.|.|. :|.:::.       
 Frog   824 LDAGSMTSSDDEEKSNPKHALSNKYNGFEDKRKSLRTGFYTGFSETPEKKIKLLNNSEERLRAKD 888

  Fly   966 -----STAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGR 1025
                 |:.....|....:|...:.:...|.:.|:: .|.::|||:.|.  .|..|||...|...:
 Frog   889 RKDVWSSIQGQWPKKTLKELFSDSDTEGATSPSTR-NQDESSSLQQSH--DNIRMSSSEVSKPEK 950

  Fly  1026 DYDL-------SEIRSELKGF-----------------QPKLLTNAASNEERKD-LAKKEPSDEP 1065
            |..|       :||..:...|                 .|..|:.....:.:.| |...||:.|.
 Frog   951 DNGLKPVDERAAEISDKKIDFPSSGSNSVLNTPPTTPESPSTLSECQKQQSKSDILDTLEPNQEE 1015

  Fly  1066 A-------------------LQDIKKEPKLE--------SSAKSSSTELSSETESYADE------ 1097
            .                   |||::.|.:..        ||:.|:..|..|:.:|:.::      
 Frog  1016 VQSMKSETDSTIEVDSVTCELQDLQYEGRFSPTGFDASISSSSSNQQEPESKEKSHTNQAVDQTV 1080

  Fly  1098 ---DSQSSDYRKQLKGSGAGKKEPTASPSKLHH----EPVTKRE-----LAVKEEPLKIEPK--- 1147
               |:.|...::..|.|...||....:.|....    |.:||.:     :.:|.:|.|:..:   
 Frog  1081 NVGDNSSKKLKRSHKSSVFQKKRKITNTSDSEDLSGGESLTKMQSERPNVGLKSQPTKVPLRVHS 1145

  Fly  1148 ----TEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLT 1208
                .:.:|::|..|.:   ||..|               :....|...|...|.|         
 Frog  1146 PGKYAKNREKDTFQKEY---ADRLP---------------KVYKWSFQMSDLEKMT--------- 1183

  Fly  1209 IGGKKSVEQ--HVPKKAELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMPAACSPSSSS 1271
                 |:|:  .:.:|.:.|:|.........||.....:..||.....|   |...::.||||||
 Frog  1184 -----SIERIAFLQEKLQELRKHYLSLKSEVASIDRRRKRCKKKERESA---VVSSSSSSPSSSS 1240

  Fly  1272 SSSSSFCSTGSAVSSSSATRSLP 1294
            .:::...:......|||:..::|
 Frog  1241 ITAAVMLTLAEPTLSSSSQNAMP 1263

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 38/93 (41%)
ARID 299..381 CDD:279697 36/87 (41%)
Tudor-knot 692..751 CDD:288553 24/59 (41%)
arid4bXP_004914677.1 TUDOR 77..132 CDD:197660 35/59 (59%)
RBB1NT 188..277 CDD:285392 38/93 (41%)
ARID 321..407 CDD:198082 37/91 (41%)
Tudor-knot 559..611 CDD:288553 24/56 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104861714
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.