DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid4a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_012824464.1 Gene:arid4a XenbaseID:XB-GENE-983782 Length:1309 Species:Xenopus tropicalis

Alignment Length:1450 Identity:382/1450 (26%)
Similarity:570/1450 (39%) Gaps:392/1450 (27%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:..|:|..|.|||:|||||:|||||||:..|.|.:||||..||...:.:|.||.:|.|   |||
 Frog     1 MKAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVTLKQDNSTQLVQDDQVKGP---LRV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            ||.||::..|... .||.|:|:.|.|.|||||||||..|||||:||||..|||.|||||||||||
 Frog    63 GATVEMKTTDGSP-QEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRR------RGHLNEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKK 187
            :|||||.||:|.:  ||||      .....|:|||::|| |.|.:   .:|.:||:|.|:. |..
 Frog   127 NPEHFGTPVIGKKTNRGRRSSLPMTEDEKEEESSEEEDE-DLKRL---NDELLGKIVSVQC-SLP 186

  Fly   188 KDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDV--PAVQ 250
            ||   ||.||||:|:......:: ||:.|||||.|.::::|.:|:.||....|.:.:..  ..||
 Frog   187 KD---WFTALVVSPSCSDDASVK-KDQCLVRSFVDSKFHSVARKDLTEVDVNVLNSEHFGKQGVQ 247

  Fly   251 AALEFLDSSVLPAHWDRDSLFGLTNISSDDE-GEIDSDSSDD--------EPHE-----EKDRFV 301
            .|:.||.|..:|..|..|....|.:.|||:| ||.|:..||.        ||.|     |:|.|:
 Frog   248 DAIAFLISKTIPEKWKMDMNEILESSSSDEEDGEDDACDSDQNKEEEVETEPEEEADPAERDIFL 312

  Fly   302 AQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSV 366
            .||||:|:|||||:||.|.:..:|::|::|||.|.::||.:.:.|...||.|.|.||......:.
 Frog   313 QQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYQQGGCDNIESGAVWKQIYMDLGIPILNSAA 377

  Fly   367 MNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLA 431
            ...||.||||:|..:.::.|...........|                .|||:|..|.|      
 Frog   378 SYNVKTAYKKYLYGFEEYCRSANIQFRTIHHN----------------DPKPIEEPKVE------ 420

  Fly   432 QPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSAASS 496
                                             .:...|.|.....:|.:::...|:...|.:||
 Frog   421 ---------------------------------EEKPMESSEQKETASPLLDAKMKEEDESDSSS 452

  Fly   497 QQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIAT 561
            :.||        ||..|.:::.     .|....|..|....|....|.....::..         
 Frog   453 EYGK--------EETETEMKSP-----RGRRRCAFNAFSVVTDVEDSDTRKDNNKE--------- 495

  Fly   562 TAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDASPSVAA 626
               |||.|.||               ..:.|||.:.|:....|...:|...:..:.:|.|     
 Frog   496 ---NKDIEEDL---------------NKTEEKEEDESTPVRRSLQCRAKGDQKTKKQDES----- 537

  Fly   627 PPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEKIDTGDFV 691
                                       .:::|::.:|..|.|:.|..|.:.|:   |..||.|..
 Frog   538 ---------------------------ERESDEDDEKPCEGKEDSEHKGETEE---EDEDTEDRD 572

  Fly   692 VGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPRERIAENLT 756
            ...|.|:||.|...|:.    ..|||.:....|..|..:|||||.|||.||||||..:||.....
 Frog   573 YLAGTKVKVKYGRGKTQ----KIYEANIKSTEVDGGELLYLVHYYGWNVRYDEWVKADRIIWPSD 633

  Fly   757 KGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCSKMSP 821
            ||..:|.:...|.:.:.                                 ::::...|..||.  
 Frog   634 KGGPKKKQKKKTKNKDE---------------------------------NEEKKEDDKRSKR-- 663

  Fly   822 SSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPRSTTPSSVVAHSGR 886
                    |.|.|.     ::...::...:.|||.:.|....:...:|:...|:..:.:      
 Frog   664 --------GRPPLK-----SAHQTNMTCGLPKTPTSEGKTSVKNMRNSLSDSSSLSNGL------ 709

  Fly   887 TKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEPVRRPKRQSAKDKPQAGK 951
                        :...:|.||...|.....|.|:.|..|||:||...     ::.|.|::....|
 Frog   710 ------------EGSARRRTRRSSGLYDSDRCSNDSSTSESESDETS-----EKASVKEEEVLPK 757

  Fly   952 AQPPGKGRLA-------------------SSASSTAPAAHPSDDSEE------------DEEEEE 985
            |:...:..|:                   ...|.|.||.....:.||            :|.||.
 Frog   758 AEEEPENILSLVDISPVKEVPPVICLLKDPEHSPTKPAETLKQEVEECEQIVQIYGKQTEELEEI 822

  Fly   986 PSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDY---------DLSEIRSELKGFQP 1041
            ..|.....||.::   |..:.|.....:.:|:.........:         .||.::|:...|.|
 Frog   823 KEAEHLPKSKGRR---SKTKDSSVENTKCLSATQEDTLVEPHVEEDTLDLPSLSPLQSKELPFTP 884

  Fly  1042 K--LLTNAASNEERKDLAKK--EPSDEPALQDIKKEPKLESSAKSSSTELSSETESYAD---EDS 1099
            |  .|.|....:|:|.|.:|  |.|........:.:|:|........||.::|.:.:.:   ||.
 Frog   885 KEAELPNDQLAQEKKGLKRKPLEQSSPDKKLRTECDPELPVIVAEEKTEENNEAQEHFNTIHEDE 949

  Fly  1100 QSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKIEPKTEPKEEETKSKPFLSGA 1164
            :..:..:::         |:.: ::|.|...|:.:  ..:.||          .|..:.|:....
 Frog   950 ELPNVNEEM---------PSLT-AELEHVHSTRTD--EFDIPL----------NEITNMPYQEDQ 992

  Fly  1165 DIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTIGGKKSVEQ-----HVPKKAE 1224
            |..||       .|..:........|......|...:::||         |||     |.|....
 Frog   993 DTMPT-------IGPENLVCHEVDLGDFDEKDKVEDIVMEK---------VEQDTQTIHPPTLPP 1041

  Fly  1225 LLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMPA------ACSPSSS----SSSSSSFCS 1279
            .::..|.......|.|...|...|  :|...:::|:..|      .|...|:    :|::||.||
 Frog  1042 AIQPHSYSVASPLALSHDESHSIK--SESDITIEVDSVAEESQEGLCESESANGFEASTTSSNCS 1104

  Fly  1280 -----------------------------------TGSAVSSSS--------ATRSLPDMSKLEI 1301
                                               |...:|:||        .:....|:|.|:.
 Frog  1105 VTAQEADITEKGNFITCHKRINESLSGSLAKKQKRTPKRISTSSKVEKNGIGQSSDSEDLSTLDT 1169

  Fly  1302 SSGTVPGATPGAAALQPSNV 1321
            ||...|...||  .|:|..:
 Frog  1170 SSKCTPIKHPG--VLKPQKI 1187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 34/93 (37%)
ARID 299..381 CDD:279697 36/82 (44%)
Tudor-knot 692..751 CDD:288553 26/59 (44%)
arid4aXP_012824464.1 TUDOR 58..113 CDD:197660 34/59 (58%)
RBB1NT 171..259 CDD:285392 34/93 (37%)
BRIGHT 308..397 CDD:128777 37/89 (42%)
Tudor-knot 576..629 CDD:288553 27/57 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104880024
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.700

Return to query results.
Submit another query.