DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid5b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_006514192.1 Gene:Arid5b MGIID:2175912 Length:1214 Species:Mus musculus

Alignment Length:1186 Identity:228/1187 (19%)
Similarity:393/1187 (33%) Gaps:353/1187 (30%)


  Fly    23 AFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRVGAVVEVRHPDRKELVEATITKI 87
            |.|..:.|:|:| :::..|.....||....|:.|                     .:.|..|.|:
Mouse    90 ALCLPRQSRVIR-LRLLRAASSAPGSRAFEDEVI---------------------AVSEKVIVKL 132

  Fly    88 QDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLTHPEHFGNPVVGGRRGRRRGHLN 152
            :|    .|.:...|.:..|    |   |......:|         |.|      ||.|::...|.
Mouse   133 ED----LVKWAHSDFSKWR----C---GLRATPVKT---------EAF------GRNGQKEALLR 171

  Fly   153 EDSSEDDDESDAKEVVNEK------EENIGKVV------CVETESKKKDKEKWFPALVVAPTAQA 205
            ...|..:...:.|:|:.||      ||....:|      |......|:.::|  |:.::  |.|.
Mouse   172 YRQSTLNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQDK--PSSIL--TDQF 232

  Fly   206 TVRI-----------------------RVKDEYLVRSFK---DGRYYTVPKKEATEFTREVASKQ 244
            .:.:                       .:::|.:...|.   .||    |:|:.|...|      
Mouse   233 ALALGGIAVVSRNPQILYCRDTFDHPTLIENESVCDEFAPNLKGR----PRKKKTCPQR------ 287

  Fly   245 DVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDS----------------------D 287
                                  |||..|..:.:::.:|::.|                      .
Mouse   288 ----------------------RDSFSGSKDPNNNCDGKVISKVKGEARSALTKPKNNHNNCKKT 330

  Fly   288 SSDDEP--------HEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRV 344
            |::::|        ..::..|:..|||||.:|.||:.::|.:..:.::|:.:|:|.||.|||..:
Mouse   331 SNEEKPKLSIGEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETI 395

  Fly   345 TSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDF-------------HRKLGCSMLMTS 396
            |::.|||.|...||..|.:.|.....::.|::.:.||..|             .||...:   |.
Mouse   396 TARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRKQENN---TQ 457

  Fly   397 RNSNRSK--GRSLVRANSVA-------SPKPMETMKT--------ETISKLAQPN-----QTNVV 439
            .|.|::|  |...::.....       :|||.:|.:.        ||::..:.|.     :....
Mouse   458 ENENKTKVSGNKRIKQEMAKNKKEKENTPKPQDTSEVSSEQRKEEETLNHKSAPEPLPAPEVKGK 522

  Fly   440 ASTSSSAAAASVAASSTPARAVST----ASQSAAEESGNTSESSVVVEPPKKQRKGSAASSQQGK 500
            ........|.:..:.:.|.:|..|    .|:..|||.|:...:.::..||....|.||.:...||
Mouse   523 PEGHKDLGARAPVSRADPEKANETDQGSNSEKEAEEMGDKGLAPLLPSPPLPPEKDSAPTPGAGK 587

  Fly   501 ------VKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSG--GSA 557
                  ...:..|.|.|......:....:.|:..|:.:|..|..::..........||:.  .:.
Mouse   588 QPLASPSTQMDSKQEAKPCCFTESPEKDLQGAPFSSFSATKPPLTSQNEAEEEQLPATANYIANC 652

  Fly   558 TIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNI-----------------SSGSSASA 605
            |:....:..|   |:..| :|............|.|:.::                 |.|:....
Mouse   653 TVKVDQLGSD---DIHTA-LKQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYTPLLYSRGNPGIM 713

  Fly   606 SSKANSAEMQRSRDASPSVAAP---PSAGASTSGAAATAQTASNKKEKH--QRSKQADKEKDKDK 665
            |..|....:.:...||.|.:.|   |....|.....|.....|...:.|  |.|......:....
Mouse   714 SPLAKKKLLSQVSGASLSSSYPYGSPPPLISKKKLIAREDLCSGLSQGHHSQSSDHTAVSRPSVI 778

  Fly   666 EEKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSPSSH--GSTYEAKVIEISVQRG- 727
            :..|:...|..:::.|:..|..       .|||..:...:...|.|  ||..::.:::...|.| 
Mouse   779 QHVQSFKNKASEDRKSINDIFK-------HDKLSRSDAHRCGFSKHQLGSLADSYILKQETQEGK 836

  Fly   728 -------------VPMYLVHYTGWNNRYDEWVPRERIAENLTKGSKQKTRTISTSSANSGSGGGG 779
                         ||.:|..:....:.:..:...|....| .:.||...|.....|.|       
Mouse   837 DKLLEKRAVSHAHVPSFLADFYSSPHLHSLYRHTEHHLHN-EQSSKYAARDAYQESEN------- 893

  Fly   780 GGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPGKDGCS---------KMSPSSGNSTGPGAPSLS 835
                          |:.|         |.|.|.|...:         |...::..||......||
Mouse   894 --------------GAFL---------SHKHPEKIHVNYLASLHLQDKKVAAAEASTDDQPTDLS 935

  Fly   836 GSLGGASSTPSLLSTVV--KTPPTGGAKRGRGRSD----SMPPRSTTPS----SVVAHSGRTKSP 890
                 ....|..|::.|  ....|.|::..:|.|.    |...|...|.    |.:..||..|.|
Mouse   936 -----LPKNPHKLTSKVLGLAHSTSGSQEIKGASQFQVVSNQSRDCHPKACRVSPMTMSGPKKYP 995

  Fly   891 -AASQPQLQQQMKKRPTRVVPGTTTP---RRVSDASMASESDSDSDEPVRRPKRQSAKDKPQ--A 949
             :.::.....|::....|.:.|...|   |::|..::.:          .||.::|.:|...  |
Mouse   996 ESLARSGKPHQVRLENFRKMEGMVHPILHRKMSPQNIGA----------ARPIKRSLEDLDLVIA 1050

  Fly   950 GKAQPPGKGRLASSASSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRA 1014
            ||               .|.|..|.|.::|...:|          |..:|::...:|:..|    
Mouse  1051 GK---------------KARAVSPLDPAKEASGKE----------KASEQESEGNKGAYGG---- 1086

  Fly  1015 MSSGAASAKGRDYDLS 1030
             .||||| :|....||
Mouse  1087 -HSGAAS-EGHKLPLS 1100

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 18/129 (14%)
ARID 299..381 CDD:279697 29/82 (35%)
Tudor-knot 692..751 CDD:288553 13/75 (17%)
Arid5bXP_006514192.1 BRIGHT 346..438 CDD:128777 31/92 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104463733
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.