DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID4A

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_016877049.1 Gene:ARID4A HGNCID:9885 Length:1284 Species:Homo sapiens

Alignment Length:1430 Identity:360/1431 (25%)
Similarity:551/1431 (39%) Gaps:417/1431 (29%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:..|:|..|.|||:|||||:|||||||:..|.|.:||||..||...:.:|.||.:|.|   |||
Human     1 MKAADEPAYLTVGTDVSAKYRGAFCEAKIKTVKRLVKVKVLLKQDNTTQLVQDDQVKGP---LRV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            ||:||.|..| ....||.|:|:.|.|.|||||||||..|||||:||||..|||.|||||||||||
Human    63 GAIVETRTSD-GSFQEAIISKLTDASWYTVVFDDGDERTLRRTSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRR------RGHLNEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKK 187
            :|||||.||:..:  ||||      .....|:|||::||.  |..:|  :|.:||||.|.:.:  
Human   127 NPEHFGTPVIAKKTNRGRRSSLPVTEDEKEEESSEEEDED--KRRLN--DELLGKVVSVVSAT-- 185

  Fly   188 KDKEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEF------TREVASKQDV 246
             ::.:|:||||::|:....:.:: ||:.|||||.|.::|::.:|:..|.      ..|:::|   
Human   186 -ERTEWYPALVISPSCNDDITVK-KDQCLVRSFIDSKFYSIARKDIKEVDILNLPESELSTK--- 245

  Fly   247 PAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDE-GEIDSDSSDDEPH---------------E 295
            |.:|.|..||.:.|:|.:|..|....|.:.||||| |..:.:..:.|..               |
Human   246 PGLQKASIFLKTRVVPDNWKMDISEILESSSSDDEDGPAEENDEEKEKEAKKTEEEVPEEELDPE 310

  Fly   296 EKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFT 360
            |:|.|:.||||:|:|||||:||.|.:..:|::|::|||.|..:||.:.:.|...||.|.|.||..
Human   311 ERDNFLQQLYKFMEDRGTPINKPPVLGYKDLNLFKLFRLVYHQGGCDNIDSGAVWKQIYMDLGIP 375

  Fly   361 PCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTE 425
            ....:....||.||:|:|..:.::.|...........:..:.|          ...|.:|....|
Human   376 ILNSAASYNVKTAYRKYLYGFEEYCRSANIQFRTVHHHEPKVK----------EEKKDLEESMEE 430

  Fly   426 TISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRK 490
            .: ||.|......|              .|.|...:.:.|:|..||        :.::.|:.:|:
Human   431 AL-KLDQEMPLTEV--------------KSEPEENIDSNSESEREE--------IELKSPRGRRR 472

  Fly   491 GSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGG 555
            .:.      .|.|:.::.||:.|..:...:.|                                 
Human   473 IAR------DVNSIKKEIEEEKTEDKLKDNDT--------------------------------- 498

  Fly   556 SATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSRDA 620
                    .|||.:.|...|                ||:.|                |:...|..
Human   499 --------ENKDVDDDYETA----------------EKKEN----------------ELLLGRKN 523

  Fly   621 SPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVE-K 684
            :|                        |:::.:..||.|.:||.|:||:::...:..:.|...| :
Human   524 TP------------------------KQKEKKIKKQEDSDKDSDEEEEKSQEREETESKCDSEGE 564

  Fly   685 IDTGDFVVGI-GDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPR 748
            .|..|....: |.|:||.|...|:.    ..|||.:....:..|..:|||||.|||.||||||..
Human   565 EDEEDMEPCLTGTKVKVKYGRGKTQ----KIYEASIKSTEIDDGEVLYLVHYYGWNVRYDEWVKA 625

  Fly   749 ERIAENLTKG---SKQKTRT--------------------------ISTSSAN-----SGSGGGG 779
            :||...|.||   .|||.:.                          .||.|:|     |.:....
Human   626 DRIIWPLDKGGPKKKQKKKAKNKEDSEKDEKRDEERQKSKRGRPPLKSTLSSNMPYGLSKTANSE 690

  Fly   780 GGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQPG--------------KDGCSKMSPSSGNSTGPG 830
            |..|...........|.|..|.:....||.:..              ||...|....:.:.....
Human   691 GKSGTRSARSNIPDSSPLSNGMEDSCSSDSETEDALEKNLINEELSLKDELEKNENLNDDKLDEE 755

  Fly   831 APSLSGSL------------------------------GGASSTPSLLSTVVKTPPTGGAKRGRG 865
            .|.:|..:                              .....|..:.....|:|      :|:|
Human   756 NPKISAHILKENDRTQMQPLETLKLEVGENEQIVQIFGNKMEKTEEVKKEAEKSP------KGKG 814

  Fly   866 RSDSMPPRSTTPS---SVVAHSGRTKSPAASQPQLQQQMKKRPTRVVPGTTTPRRVSDASMASES 927
            |      ||.|..   .::..|...::.|.|:|.::....:..:           :.:.:.:|.:
Human   815 R------RSKTKDLSLEIIKISSFGQNEAGSEPHIEAHSLELSS-----------LDNKNFSSAT 862

  Fly   928 DSDSDEPVRRPKRQSAKDKPQAGKAQPPGKGRLAS--SASSTAPAAHPSD-----------DSEE 979
            :.:.|:.|:..|.:    :...|::.|..|.|:.:  ..::|......||           ..:.
Human   863 EDEIDQCVKEKKLK----RKILGQSSPEKKIRIENGMEMTNTVSQERTSDCIGSEGMKNLNFEQH 923

  Fly   980 DEEEEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKGRDYDLSEIRSELKGFQPKLL 1044
            .|.|.|...:..|.|.|..||.:|.|         ..|.|....  :..|.|....:....|:.|
Human   924 FERENEGMPSLIAESNQCIQQLTSER---------FDSPAEETV--NIPLKEDEDAMPLIGPETL 977

  Fly  1045 TNAASNEERKDLAKKEPSDEPALQDIKKE-----------PKL-------------------ESS 1079
            ..     ...||...:..|:.:::|:..|           |.|                   ||.
Human   978 VC-----HEVDLDDLDEKDKTSIEDVAVESSESNSLVSIPPALPPVVQHNFSVASPLTLSQDESR 1037

  Fly  1080 AKSSSTELSSETESYADEDSQSSDYRKQLKGSGAGKKEPTASPSKLHHEPVTKRELAVKEEPLKI 1144
            :..|.::::.|.:|.|:|..:....|:...|........|.|             :.|:|     
Human  1038 SVKSESDITIEVDSIAEESQEGLCERESANGFETNVASGTCS-------------IIVQE----- 1084

  Fly  1145 EPKTEPKEEETKSKPFLSGADIKPTALIAPARFGNTSAAQAASSSGSSSTTAKYTSVIVEKPLTI 1209
                  :|...|.|.||..:..:|                   |.|:|...||            
Human  1085 ------RESREKGKDFLGKSQKRP-------------------SDGNSGLMAK------------ 1112

  Fly  1210 GGKKSVEQHVPKK-AELLKKQSGGAGGTAASSSAASQESKKFAEPVASLKVEMP--AACSPSSSS 1271
                 .::..||: :...|.:..|.|.::.|......::.....||..|.|..|  .|.||:..|
Human  1113 -----KQKRTPKRTSAAAKNEKNGTGQSSDSEDLPVLDNSSKCTPVKHLNVSKPQKLARSPARIS 1172

  Fly  1272  1271
            Human  1173  1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 31/97 (32%)
ARID 299..381 CDD:279697 35/82 (43%)
Tudor-knot 692..751 CDD:288553 25/60 (42%)
ARID4AXP_016877049.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C104880322
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 392 1.000 Inparanoid score I1970
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T610158
orthoMCL 1 0.900 OOG5_131238
Panther 1 1.100 LDO PTHR13964
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.