DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid3b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_005163185.1 Gene:arid3b ZFINID:ZDB-GENE-070209-182 Length:616 Species:Danio rerio

Alignment Length:563 Identity:127/564 (23%)
Similarity:199/564 (35%) Gaps:159/564 (28%)


  Fly   148 RGHLNEDSSEDDDESDAKEVVNEKEENIG-------------KVVCVETESKKKDKEKWFPALVV 199
            ||..:|...:||||....|..:|:||:.|             ..|.|...|        ||....
Zfish   135 RGRGSEGDEDDDDEMMDGEDGSEEEESEGLEFLRKQSLALQQAAVGVPPYS--------FPVYTA 191

  Fly   200 APTA----QATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQAALEFLDSSV 260
            :|:|    ..:...:|||| ...|..|.:.:..|..                             
Zfish   192 SPSAAKKRPLSPTTKVKDE-PEDSLSDQQSFNTPNG----------------------------- 226

  Fly   261 LPAHWDRDSLFGLTNISSDDE--------GEIDSDSS-----DDEPHEEKDRFVAQLYKYMDDRG 312
             ...|:.|..|.....||.:|        ||...|.:     |::|  ::..|:..|:.||..||
Zfish   227 -MGDWNLDDSFKQNGNSSWNEEGDGGRSRGEASRDFAKLYELDNDP--KRKEFLDDLFAYMQKRG 288

  Fly   313 TPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKF 377
            ||:|::|.:..:.:|||.|::.|.::||...|.::..|:.|...|.......|....::..|.|:
Zfish   289 TPVNRIPIMAKQVLDLYMLYKLVTEKGGLVEVINKKIWREITKGLNLPTSITSAAFTLRTQYMKY 353

  Fly   378 LQPYGDFHRKLGCSM---LMTSRNSNRSKGR------SLVR--------ANSVASPKPMETMKTE 425
            |.||.  ..|.|.|.   |..:.:|||.:||      ||.|        |..:.||..|....|.
Zfish   354 LYPYE--CEKKGLSSPGELQAAIDSNRREGRRPGYSNSLYRFSPSPSGAAPHLLSPPKMHLPATG 416

  Fly   426 TISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEE--------------SGNTS 476
            .....|.|:.....|:....:.|:.:.|....|.|:....|.|...              :|..:
Zfish   417 HNELQATPSPALKKATVPEDSPASMLPARLPLALALGHQQQLARAATLEQLRERLETGMGAGAVN 481

  Fly   477 ESSVVVEPPKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAA 541
            ....|||.|::            |:..|.|  |::....||.....:|     .::...||....
Zfish   482 AGPAVVEGPER------------KMARLAE--EQQRLLQQAFQQNLLA-----MASQVNPTNLRM 527

  Fly   542 ASTAT-----NLS-SATSGGSATIATT----------AMNKDAESDLPLAKIKAAAVAAASTRHS 590
            .:..|     :|| |.:|.|||:|..:          ::.......:|      .||.|....|:
Zfish   528 NNANTREEKQDLSLSISSNGSASITVSVEVNGIIYSGSLYAQKSGSVP------TAVTAMFPGHT 586

  Fly   591 MEKETNISSGSSASASSKANSAEMQRSRDASPSVAAPPSAGAS 633
            ......::|.||:|:|...:|.:              |:.|.|
Zfish   587 STLSPGVASSSSSSSSKGPDSVD--------------PATGGS 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 17/108 (16%)
ARID 299..381 CDD:279697 26/82 (32%)
Tudor-knot 692..751 CDD:288553
arid3bXP_005163185.1 BRIGHT 271..363 CDD:128777 29/96 (30%)
DUF4251 <523..566 CDD:290766 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.