DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid3c

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_005165415.1 Gene:arid3c ZFINID:ZDB-GENE-060526-12 Length:599 Species:Danio rerio

Alignment Length:526 Identity:123/527 (23%)
Similarity:208/527 (39%) Gaps:93/527 (18%)


  Fly   136 GNPVVGGRRGRRRGHLNEDSSEDDDESDAKEV---VNEKEENIGKVVCVETESKKKDKE------ 191
            |:|:      .||.  ..|..::|||.|..|:   ::::|.::.:...:......:|.|      
Zfish   110 GHPL------ERRA--ESDIDDEDDEDDDPELDRGMDDEERDMDEDDSMNEGGGDEDLEGPLAHY 166

  Fly   192 ----KWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEAT--EFTREVASKQDVPAVQ 250
                ..:|....:|.:......||:..|......:......|:.::.  |:|.|...||......
Zfish   167 PPRHAVYPGAGQSPKSTPIHLSRVQPPYPAPRQAESPSALAPQAQSQHHEWTYEEQFKQSGQGSG 231

  Fly   251 AALEFLDSSVLPAHWDRDSLFGLTNISS--DDEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGT 313
            ...:..||||         .||....||  .:..|:|.|       |::..|:..|:.:|..|||
Zfish   232 PGRKLKDSSV---------AFGGGGSSSLIQELYELDDD-------EKRKEFLDDLFSFMQKRGT 280

  Fly   314 PLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFL 378
            |:|::|.:..:.:|||.|::.|.::||...|.::..|:.|...|.......|....::..|.|:|
Zfish   281 PVNRIPIMAKQVLDLYTLYKLVTEKGGLVEVINKKIWREITKGLNLPTSITSAAFTLRTQYMKYL 345

  Fly   379 QPYGDFHRKLGC-SMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPN-------- 434
            .||....|.|.. ..|..:.:|||.:||.....:::.:..|:.|.......||..|:        
Zfish   346 YPYECEKRGLSSPGELQAAIDSNRREGRRQSYGSTLFNYSPVGTPTLLASPKLQMPHISMPTPNG 410

  Fly   435 ----QTNVVASTSSSAAAA---------SVAASSTPARAVSTASQSAA--EESGNTSESSVVVEP 484
                ||..:....|..::.         |:|...:.|:|.:.|:..||  |:.....||.   ||
Zfish   411 GHMTQTPGIKKEDSMLSSCLTNRVGIPMSLAGHHSAAQAAAAAAVQAAALEQLREKLESG---EP 472

  Fly   485 PKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLS 549
            |:|            ||..:.|  |::.....|......|.:........:........||.|||
Zfish   473 PEK------------KVMLMAE--EQQRIMQHALQQNLFAMATQLPMNIKLNNRDDRQETALNLS 523

  Fly   550 SATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTR----HSMEKETN---ISS--GSSASA 605
              |:|.|:...:..:|....:.:..|:..|.....:|.|    ||.:.::|   :||  ..|:||
Zfish   524 --TNGISSINMSIEINGVVYTGVLFARKPAIGFMPSSQRVHHQHSSQGKSNSPGLSSHIQPSSSA 586

  Fly   606 SSKANS 611
            ||.|:|
Zfish   587 SSSASS 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 18/103 (17%)
ARID 299..381 CDD:279697 25/82 (30%)
Tudor-knot 692..751 CDD:288553
arid3cXP_005165415.1 BRIGHT 262..354 CDD:128777 28/92 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.