DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid3b

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_062663.1 Gene:Arid3b MGIID:1930768 Length:568 Species:Mus musculus

Alignment Length:615 Identity:132/616 (21%)
Similarity:226/616 (37%) Gaps:169/616 (27%)


  Fly   113 KSGRHFNESETL---------DQLPLTHPEHFGNPVVGG----------RRGRRRGHLNEDSSE- 157
            |.|....||:.|         ..|.:|.....|:.|:|.          .|...:.::|.:..| 
Mouse    28 KQGPQTRESQFLYASKLGTQPALLSITPGRPSGSSVLGPLARVPPATPVARMSEQSNVNSEPEEE 92

  Fly   158 ------DDDESDAKEVVNEKEENIGKVVCVETESKKKDK----EKWFPALVVAPTAQATVRIRVK 212
                  :|.:.|..||..::.:...|...::..::::.:    ....|...::|..|.|.....|
Mouse    93 EGGLEDEDGDDDVAEVAEKEAQAASKYFHMQKVTRQEPRATPMSSLLPVPGLSPQGQQTKEDHTK 157

  Fly   213 DEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQAALEFLDSSVLPAHWDRDSLF---GLT 274
            |                           |||.. |:|..|.:       |: |..|...   |..
Mouse   158 D---------------------------ASKAP-PSVPTAGQ-------PS-WSLDEQLKQNGAL 186

  Fly   275 NISSDDEG----EIDSDSS-----DDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDLYR 330
            ..|.|.:|    ||..|.:     |.:|  |:..|:..|:.:|..||||:|::|.:..:.:|||.
Mouse   187 AWSDDADGGRGREISRDFAKLYELDGDP--ERKEFLDDLFIFMQKRGTPINRIPIMAKQILDLYM 249

  Fly   331 LFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGC-SMLM 394
            |::.|.::||...:.::..|:.|...|.......|....::..|.|:|..|....:.|.. :.|.
Mouse   250 LYKLVTEKGGLVEIINKKIWREITKGLNLPTSITSAAFTLRTQYMKYLYAYECEKKALSSPAELQ 314

  Fly   395 TSRNSNRSKGRSLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPAR 459
            .:.:.||.:||....::|:....|...                ..|:.:::|||||.|::.|||.
Mouse   315 AAIDGNRREGRRPSYSSSLFGYSPAAA----------------AAAAAAAAAAAASAASAGTPAL 363

  Fly   460 AVSTA---SQSAAEESGNTSESSVVVEPPKKQRKGSA-------------------ASSQQGKVK 502
            ..|..   |......|..||.||..:.|....|||..                   |.::.|.::
Mouse   364 LSSPKIRFSILGLGSSSGTSASSPRIPPASTLRKGDGVPVPVPNRLAVSGTLAGQQAGNRPGPLE 428

  Fly   503 SLVEKY------EEKSTAVQATSSGTVAGS---GASASAAAMP---------TTSAAASTATNLS 549
            .|.|:.      |:|::.:.......|..:   ...:.|..:|         ..:..::.|.||:
Mouse   429 HLRERLESGEPPEKKASRLSEEEQRLVQQAFQRNLFSMARQLPMKIRINGREDRAEPSAPALNLT 493

  Fly   550 SATSGGSATIATTAMNKDAESD------LPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSK 608
            ::..|        ::|...:.|      :..|:.....:.|.||..|:        |||||:|:.
Mouse   494 TSNIG--------SINMSVDIDGTTYTGVLFAQKPVVHLIAGSTPQSI--------GSSASSSNS 542

  Fly   609 ANSAEMQRSRDASPSVAA---PPSAGASTS 635
            ::|       ..|||..:   .|||..|||
Mouse   543 SSS-------HCSPSPTSSRGTPSAEPSTS 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 13/95 (14%)
ARID 299..381 CDD:279697 23/82 (28%)
Tudor-knot 692..751 CDD:288553
Arid3bNP_062663.1 Interaction with RB1. {ECO:0000250} 201..374 48/191 (25%)
BRIGHT 214..303 CDD:128777 26/91 (29%)
Interaction with ARID3A. {ECO:0000250} 495..518 4/31 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.