DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid3a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_009304080.1 Gene:arid3a ZFINID:ZDB-GENE-140106-97 Length:524 Species:Danio rerio

Alignment Length:505 Identity:106/506 (21%)
Similarity:200/506 (40%) Gaps:140/506 (28%)


  Fly   152 NEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKKKDKEKWFPALVVAPTAQATVRIRVKDEYL 216
            :.:..|||:|.|.:|..::.::.:|      :|.:::.|:|:                 .:|:: 
Zfish    73 SSEGDEDDEEEDEEEGEDQYKDMMG------SEEEEQIKQKF-----------------DEDDF- 113

  Fly   217 VRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQAALE------FLDSSVLPAHWDRDSLF---- 271
                           |..::..|:.. :.:|:.:.|:.      .|....|..|    ||.    
Zfish   114 ---------------EEEDYDEELGD-EGLPSGREAVTPGRGILLLPHRQLQPH----SLMLKAR 158

  Fly   272 --------GLTNISSDDEGEIDSDSSDDEPHEEKDR-------------FVAQLYKYMDDRGTPL 315
                    .||:.:...:|.:......|..:||:.|             |:..|:.:|..:|||:
Zfish   159 PGSESEARALTHSAHSSQGPLHGQDHADWTYEEQFRQLYELDSDPKRKEFLDDLFSFMQKKGTPV 223

  Fly   316 NKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQP 380
            |::|.:..:.:|||.|::.|.::||...|.::..|:.|...|.......|....::..|.|:|..
Zfish   224 NRIPIMAKQVLDLYMLYQLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYT 288

  Fly   381 YGDFHRKL-GCSMLMTSRNSNRSKGRSLVRANSV--ASPKPMETM-----KTETISKLAQPN--- 434
            |....|.| ..:.|..:.:|||.:||.....||:  .||....||     :|.:...:|.|:   
Zfish   289 YECEKRALSNPNELKAAIDSNRREGRRQGFGNSLFTYSPNGTPTMLSSPKRTMSSMGIALPSNGA 353

  Fly   435 ---------------QTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEP 484
                           ||.:.||.::.:.||:.||:   |:|.:.|..:|.|:..:..|:.   ||
Zfish   354 SISSIQNIKKEDDGFQTRLPASLATHSVAAAQAAA---AQAATIAQVAALEQLRDNLETG---EP 412

  Fly   485 PKKQ----------------RKGSAASSQQGKVKSLVEKYEEK-STAVQATSSGT---------- 522
            |:|:                :....|.:.|..:...:...|.: .:|:..|::|.          
Zfish   413 PRKKIALPLEEHQRLLQRALQHNLMAMTAQIPMNIRINNQESRPDSAMNLTTNGLNSISMSLELN 477

  Fly   523 -VAGSGASASAAAMPTTSAAASTATNLSSATSGGSATIAT-TAMNKDAES 570
             |..:|. ..|.::..||..||   |.|:..||..:.:.| |:.:.:.:|
Zfish   478 GVVYTGV-LFAQSVAQTSLGAS---NKSTGNSGPQSVLHTPTSSSSNNQS 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 11/97 (11%)
ARID 299..381 CDD:279697 24/95 (25%)
Tudor-knot 692..751 CDD:288553
arid3aXP_009304080.1 BRIGHT 203..294 CDD:128777 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.