DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and ARID4B

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001193723.1 Gene:ARID4B HGNCID:15550 Length:1312 Species:Homo sapiens

Alignment Length:1398 Identity:370/1399 (26%)
Similarity:579/1399 (41%) Gaps:324/1399 (23%)


  Fly     1 MQQMDDPPSLPVGTEVSAKYKGAFCEAKVSKVVRNIKVKVAYKQGLGSGIVSDDAIKAPTGQLRV 65
            |:.:|:||.|.|||:|||||:|||||||:....|.:||||.::....:..|.||.||.|   |:|
Human     1 MKALDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGP---LKV 62

  Fly    66 GAVVEVRHPDRKELVEATITKIQDCSQYTVVFDDGDITTLRRTALCLKSGRHFNESETLDQLPLT 130
            ||:|||::.| ....||.|.|:.|.|.|||||||||..||||::||||..|||.|||||||||||
Human    63 GAIVEVKNLD-GAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETLDQLPLT 126

  Fly   131 HPEHFGNPVVGGR--RGRRRGHLNED----SSEDDDESDAKEVVNEKEENIGKVVCVETESKKKD 189
            :|||||.||:|.:  ||||..|:.|:    ||.|:||.|.|::    :|.:||||||:..|..|.
Human   127 NPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQI----DELLGKVVCVDYISLDKK 187

  Fly   190 KEKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQA--- 251
            |..|||||||.|.....:.:: ||..||||||||::.:||:|:..|.|.:.|.|.|....||   
Human   188 KALWFPALVVCPDCSDEIAVK-KDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQ 251

  Fly   252 ALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPH----------------EEKDRF 300
            ||||..|..:||:|..:    |...||..|.|.:.:..|||..                ||::.|
Human   252 ALEFHKSRTIPANWKTE----LKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENF 312

  Fly   301 VAQLYKYMDDRGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVS 365
            :.||||:|:|||||:||.|.:..|:::|::|||.|.|.||::.:.|...||.:...||     :.
Human   313 LQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLG-----IP 372

  Fly   366 VMNL-----VKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPMETMKTE 425
            |:|.     ||.||||:|..:.::.|.......|..  ..:...:......:|...|..|..:||
Human   373 VLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMAL--PEKVVNKQCKECENVKEIKVKEENETE 435

  Fly   426 TISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRK 490
             |.::....:.|::                                             |:::  
Human   436 -IKEIKMEEERNII---------------------------------------------PREE-- 452

  Fly   491 GSAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAMPTTSAAASTATNLSSATSGG 555
                       |.:.::.|.|.....:..|                                   
Human   453 -----------KPIEDEIERKENIKPSLGS----------------------------------- 471

  Fly   556 SATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSASASSKANSAEMQRSR-D 619
                     .|:....:|             |....|||.||.....   :...:..:...:| |
Human   472 ---------KKNLLESIP-------------THSDQEKEVNIKKPED---NENLDDKDDDTTRVD 511

  Fly   620 ASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKDKDKEEKQASSGKRKKEKISVEK 684
            .|.::........:.||      ..:||:|.....:..::|:::::||.:......::|:..   
Human   512 ESLNIKVEAEEEKAKSG------DETNKEEDEDDEEAEEEEEEEEEEEDEDDDDNNEEEEFE--- 567

  Fly   685 IDTGDFVVGIGDKLKVNYHEKKSPSSHGSTYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPRE 749
                  ....|.|::|.|...|:.    ..|||.:.:..|:.|..:|||||.|||.|||||:..:
Human   568 ------CYPPGMKVQVRYGRGKNQ----KMYEASIKDSDVEGGEVLYLVHYCGWNVRYDEWIKAD 622

  Fly   750 RIAENLTKG--------------SKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQG 800
            :|.....|.              .|:|.:....|..|                      ..|.:.
Human   623 KIVRPADKNVPKIKHRKKIKNKLDKEKDKDEKYSPKN----------------------CKLRRL 665

  Fly   801 SQPPGVSDKQPGKDGCSKMSPSSGNSTGPG---APSLSGSLGGASSTPSLLSTVVKTPPTGGAKR 862
            |:||  ....|..:..||:..:...::...   :..::..|.|..::.|       :......:.
Human   666 SKPP--FQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASES-------SAEDSEQED 721

  Fly   863 GRGRSDSMPPRSTTPSSVVAHSGRTKSPAASQPQ-----LQQQMKKRPTRVV--PGTTTPRRV-S 919
            .||..|.  ..:....|.:.|....::...|:.:     |.::.|.....|:  |.:.:|.|: .
Human   722 ERGAQDM--DNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPERLRK 784

  Fly   920 DASMASESDSDSDEPVRRPKRQSAK-------DKPQ--AGKAQ-----------PPGKGRLASSA 964
            |..:.|| |:|.:|.....||:..|       .|||  .||.:           .||| :...:.
Human   785 DIEVLSE-DTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKRRYCNTEECLKTGSPGK-KEEKAK 847

  Fly   965 SSTAPAAHPSDDSEEDEEEEEPSAARAASSKQQ--QQQASSLR--GSRAGGNRAM--------SS 1017
            :..:.....|.:|..||:|||..|....:.|..  :::..|||  |..:|.:...        :|
Human   848 NKESLCMENSSNSSSDEDEEETKAKMTPTKKYNGLEEKRKSLRTTGFYSGFSEVAEKRIKLLNNS 912

  Fly  1018 GAASAKGRDYDLSEIRSELKGFQPKLLTNAASNEERKDLAKKEPSDEPALQDIKKEPKLESSAKS 1082
            .......|..|..::.|.::|..||.......::...:.|...|  .||.::...|..|::.|:.
Human   913 DERLQNSRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPP--HPAPEEGVAEESLQTVAEE 975

  Fly  1083 SSTELSSETES----------YADEDSQSSDYRKQLKGSGAG---KKEPTA--SPSKLHHEPVTK 1132
            .|...|.|.|.          ..::..:.:|.:.:...||:.   ...||.  |||.     ||.
Human   976 ESCSPSVELEKPPPVNVDSKPIEEKTVEVNDRKAEFPSSGSNSVLNTPPTTPESPSS-----VTV 1035

  Fly  1133 RELAVKEEPLKIEPKTEPKEEETKSKPFLSGADIKPTALIAPAR----FGNTSAA---QAASSSG 1190
            .|.:.::..:.:.....|.:||.:|....:.:.|:..::....:    .||:|.|   .:.|||.
Human  1036 TEGSRQQSSVTVSEPLAPNQEEVRSIKSETDSTIEVDSVAGELQDLQSEGNSSPAGFDASVSSSS 1100

  Fly  1191 SSSTTAKYTSVIVEKPLT---------IGGKKSVEQHVPKKAELLKKQSGGAGGTAASSSAASQ- 1245
            |:....::.    ||..|         .||..|.:|....||.::..:..|.|..::.|...|. 
Human  1101 SNQPEPEHP----EKACTGQKRVKDAQGGGSSSKKQKRSHKATVVNNKKKGKGTNSSDSEELSAG 1161

  Fly  1246 ESKKFAEPVASLKVEMPAACSPSSSSSSSSSFC 1278
            ||...::||.|:...|.:..:.|.:.:.|...|
Human  1162 ESITKSQPVKSVSTGMKSHSTKSPARTQSPGKC 1194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 43/94 (46%)
ARID 299..381 CDD:279697 37/87 (43%)
Tudor-knot 692..751 CDD:288553 23/59 (39%)
ARID4BNP_001193723.1 TUDOR 58..113 CDD:197660 33/59 (56%)
RBB1NT 170..262 CDD:285392 43/93 (46%)
ARID 311..394 CDD:198082 37/88 (42%)
Antigenic epitope 465..473 1/52 (2%)
Tudor-knot 571..624 CDD:288553 23/57 (40%)
Antigenic epitope 1130..1137 1/7 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 392 1.000 Inparanoid score I1970
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001641
OrthoInspector 1 1.000 T610158
orthoMCL 1 0.900 OOG5_131238
Panther 1 1.100 O PTHR13964
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.850

Return to query results.
Submit another query.