DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and Arid3c

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001167452.1 Gene:Arid3c RGDID:1560943 Length:410 Species:Rattus norvegicus

Alignment Length:434 Identity:98/435 (23%)
Similarity:151/435 (35%) Gaps:111/435 (26%)


  Fly   126 QLPLTHPEHFGNPVVGGRRGRRRGHLNEDSSEDDDESDAKEVVNEKEENIGKVVCVETESKKKDK 190
            :|||..|     |::|.|                       .:...|..:|.|...|.|..::|:
  Rat    23 RLPLPQP-----PLLGAR-----------------------TLQAPEGALGVVGAEEEEGAEEDE 59

  Fly   191 EKWFPALVVAPTAQATVRIRVKDEYLVRSFKDGRYYTVPKKEATEFTREVASKQDVPAVQAALEF 255
            |...|.              |::|...:|....|....|..::             |.:|     
  Rat    60 EGETPL--------------VEEETAEQSHPGARCPNSPSGQS-------------PGIQ----- 92

  Fly   256 LDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPS 320
                  |..|..:..|       ....|:|:|       .::..|:..|:.:|..||||:|:||.
  Rat    93 ------PHEWTYEEQF-------KQLYELDAD-------PKRKEFLDDLFSFMQKRGTPVNRVPI 137

  Fly   321 ILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFH 385
            :..:.:|||.|||.|..:||...|.::..|:.:...|.......|....::..|.|:|.||....
  Rat   138 MAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECET 202

  Fly   386 RKLGC-SMLMTSRNSNRSKGR----SLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSSS 445
            |.|.. ..|..:.:|||.:||    :.|...::|.|.|.......:....|.....|...||..|
  Rat   203 RALSSPGELQAAIDSNRREGRRQAYTTVPLFNLAGPTPRGAPGPASSHGPAPTTTPNCPGSTQGS 267

  Fly   446 AAAASVAASSTPARAVSTASQSAA--EESG---------------NTSESSVVVEPPKKQR--KG 491
                   ||..||.|.:..|.|..  ||||               ...|.....|||:|:.  .|
  Rat   268 -------ASGLPAHACAQLSPSPVKKEESGIPPPRLAIPVGLALEAAREKLAPEEPPEKRAVLMG 325

  Fly   492 SAASSQQGKVKSLVEKYEEKSTAVQATSSGTVAGSGASASAAAM 535
            .....:.|...|.:.:.:......:......:||||.|:...|:
  Rat   326 PMDPPRLGATPSFLPRGKAPLREERLDGPLNLAGSGISSINMAL 369

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 15/91 (16%)
ARID 299..381 CDD:279697 27/82 (33%)
Tudor-knot 692..751 CDD:288553
Arid3cNP_001167452.1 BRIGHT 112..203 CDD:128777 28/91 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.