DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and morf4l1

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:XP_012814367.1 Gene:morf4l1 XenbaseID:XB-GENE-5750240 Length:333 Species:Xenopus tropicalis

Alignment Length:219 Identity:50/220 (23%)
Similarity:79/220 (36%) Gaps:74/220 (34%)


  Fly   711 HGS-TYEAKVIEISVQRGVPMYLVHYTGWNNRYDEWVPRERIAENL-TKGSKQKTRTISTSSANS 773
            ||. .||||.::::::.....|.:||:|||..:|||||..|:.:.: |...|||.          
 Frog    31 HGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQKE---------- 85

  Fly   774 GSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVSDKQ----PGKDGCS------KMSPSSGNSTG 828
                                   |.:.:|...|..|.    |||...:      ::........|
 Frog    86 -----------------------LQKANQDQYVEGKMRAAAPGKKTAALQQKNVEVKTKKNKQKG 127

  Fly   829 PGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSD-SMPPRSTTPSSVVAHSGRTKSPAA 892
            ||:       |..|||..     :..||    ::.|.|.| ::....|..:.|..   :.|.|..
 Frog   128 PGS-------GEGSSTSD-----IPQPP----RKKRARIDPTVESEETFMNRVEV---KVKIPEE 173

  Fly   893 SQPQL---------QQQMKKRPTR 907
            .:|.|         |:|:...|.:
 Frog   174 LKPWLVDDWDLITRQKQLFNLPAK 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392
ARID 299..381 CDD:279697
Tudor-knot 692..751 CDD:288553 18/41 (44%)
morf4l1XP_012814367.1 Tudor-knot 25..74 CDD:288553 18/43 (42%)
MRG 145..319 CDD:283390 12/57 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1624495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.