DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and arid3a

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_001011106.1 Gene:arid3a XenbaseID:XB-GENE-945264 Length:541 Species:Xenopus tropicalis

Alignment Length:472 Identity:108/473 (23%)
Similarity:185/473 (39%) Gaps:101/473 (21%)


  Fly   154 DSSEDDDESDAKEVVNEKEENIGKVVCVETESKKKD-KEKW----FPALVVAPTAQATVRIRVKD 213
            |..|:|.||.|.:..:|||.:.......:..|:::| |.||    |                 :|
 Frog    85 DEEEEDGESMASDEEDEKERDGESERYPDMGSEEEDLKGKWDEDDF-----------------ED 132

  Fly   214 EYLVRSFKD-------------GRYYTVPKKEATEFTREVASKQDVPAVQAALEFLDSSVLPAH- 264
            |.....::|             |:..|:|.|...  .:...:::.|.|.:|.|.......|..| 
 Frog   133 EGEEDDYEDMEEGMGVSEAGRVGKGSTLPPKHPN--PQAFPTQRSVGAERAGLPHTGHPQLQDHG 195

  Fly   265 -WDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFVAQLYKYMDDRGTPLNKVPSILSRDVDL 328
             |..:..|       ....|:|.|       .::..|:..|:.:|..||||:|::|.:..:.:||
 Frog   196 DWTYEEQF-------KQLYELDGD-------PKRKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDL 246

  Fly   329 YRLFRAVQKRGGYNRVTSQNQWKLIAMRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKL-GCSM 392
            |.|:..|.::||...|.::..|:.|...|.......|....::..|.|:|.||....|.| ..:.
 Frog   247 YMLYVLVTEKGGLVEVINKKLWREITKGLNLPTSITSAAFTLRTQYMKYLYPYECEKRGLSNPNE 311

  Fly   393 LMTSRNSNRSKGR------SLVRANSVASPKPMETMKTETISKLAQPNQTNVVASTSS------- 444
            |..:.:|||.:||      ||...:...:|..:.:.|.: :|.|:........:|.||       
 Frog   312 LQAAIDSNRREGRRQSFGGSLFTYSPSGAPSMLSSPKLQ-VSALSLGGVATNGSSLSSMQKIKKE 375

  Fly   445 ---------------SAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEPPKKQRKGSA- 493
                           |.|..|:.|:...|:|.:........|||...|..:.:...::||...| 
 Frog   376 EDSPISLTVPPRIPVSLAGHSMVAAQVAAQAAALEQLREKLESGEPPEKKMALGTEEQQRLQRAI 440

  Fly   494 -----ASSQQGKVKSLVEKYEE--KSTAVQATSSGT--------VAGSGASASAAAMPTTSAAAS 543
                 |.:.|..:...:....|  :.:||..|::||        :.|...:....|.|.|||:.:
 Frog   441 QHNLLAMTAQLPMNIRINSQAEGRQDSAVNLTTNGTNSISMSVELNGIVYTGVLFAQPPTSASGT 505

  Fly   544 T--ATNLSSATSGGSAT 558
            :  ::|.:.:..|||:|
 Frog   506 SKGSSNRTGSIGGGSST 522

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 20/109 (18%)
ARID 299..381 CDD:279697 25/82 (30%)
Tudor-knot 692..751 CDD:288553
arid3aNP_001011106.1 BRIGHT 213..305 CDD:128777 27/92 (29%)
Important for nuclear localization. {ECO:0000250} 408..450 8/42 (19%)
Homodimerization. {ECO:0000250} 452..473 4/21 (19%)
Important for cytoplasmic localization. {ECO:0000250} 497..504 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.