DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: htk and retn

Sequence 1:NP_573330.3 Gene:htk FlyBaseID:FBgn0085451 Length:2486 Species:Drosophila melanogaster
Sequence 2:NP_788434.1 Gene:retn FlyBaseID:FBgn0004795 Length:911 Species:Drosophila melanogaster

Alignment Length:887 Identity:169/888 (19%)
Similarity:269/888 (30%) Gaps:334/888 (38%)


  Fly   241 ASKQDVPAVQAALEFLDSSVLPAHWDRDSLFGLTNISSDDEGEIDSDSSDDEPHEEKDRFVAQLY 305
            ||....|:.:.|..|..:|.             :|.|:..|....|..::....||:.:.|.|||
  Fly   237 ASPTAAPSGKEARHFAANSA-------------SNSSTSSEASNSSQQNNGWSFEEQFKQVRQLY 288

  Fly   306 KYMDD----------------RGTPLNKVPSILSRDVDLYRLFRAVQKRGGYNRVTSQNQWKLIA 354
            :..||                ||||:|::|.:....:|||.|:..|..|||...|.::..|:.|.
  Fly   289 EINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEII 353

  Fly   355 MRLGFTPCTVSVMNLVKQAYKKFLQPYGDFHRKLGCSMLMTSRNSNRSKGRSLVRANSVASPKPM 419
            ..|.......|....::..|.|:|.||....:.|                               
  Fly   354 KGLHLPSSITSAAFTLRTQYMKYLYPYECEKKNL------------------------------- 387

  Fly   420 ETMKTETISKLAQPNQTNVVASTSSSAAAASVAASSTPARAVSTASQSAAEESGNTSESSVVVEP 484
                                               ||||..     |:|.:  ||          
  Fly   388 -----------------------------------STPAEL-----QAAID--GN---------- 400

  Fly   485 PKKQRKGSAASSQQGKVKSLVEKYEEKSTAVQAT--SSGTVAGSGASASAAAMPTTSAAASTATN 547
               :|:|..:|..|         ||.....:..|  |..::.|.....|..|:.|.:|.|:    
  Fly   401 ---RREGRRSSYGQ---------YEAMHNQMPMTPISRPSLPGGMQQMSPLALVTHAAVAN---- 449

  Fly   548 LSSATSGGSATIATTAMNKDAESDLPLAKIKAAAVAAASTRHSMEKETNISSGSSA--------S 604
                             |:.|:          ||.|||:..|.:       .|:.|        .
  Fly   450 -----------------NQQAQ----------AAAAAAAAHHRL-------MGAPAFGQMPNLVK 480

  Fly   605 ASSKANSAEMQRSRDASPSVAAPPSAGASTSGAAATAQTASNKKEKHQRSKQADKEKD---KDKE 666
            ...::...|..:...|......||..|.:.......:|....::..||:.:|...::.   :.:.
  Fly   481 QEIESRMMEYLQLIQAKKEQGMPPVLGGNHPHQQQHSQQQQQQQHHHQQQQQQQSQQQHHLQQQR 545

  Fly   667 EKQASSGKRKKEKISVEKIDTGDFVVGIGDKLKVNYHEKKSP--SSHGSTYEAKVIEISVQRGVP 729
            ::..|....|.|.:|.:.            .|...||...||  |:|.|..:.:.:.:|   ..|
  Fly   546 QRSQSPDLSKHEALSAQV------------ALWHMYHNNNSPPGSAHTSPQQREALNLS---DSP 595

  Fly   730 MYLVHYTGWNNR-------------YDEWVPRERIAENL-------------------------- 755
            ..|.:......|             .|:..|.:|:...|                          
  Fly   596 PNLTNIKREREREPTPEPVDQDDKFVDQPPPAKRVGSGLLPPGFPANFYLNPHNMAAVAAAAGFH 660

  Fly   756 --TKGSKQKTRTISTSSANSGSGGGGGGGGGGGGGGGGGGGSLLVQGSQPPGVS----------D 808
              :.|.:|          ::.|.|........|.....|..|.:...|:|..::          |
  Fly   661 HPSMGHQQ----------DAASEGEPEDDYAHGEHNTTGNSSSMHDDSEPQQMNGHHHHQTHHLD 715

  Fly   809 KQPGKDGCSKMSPSSGNSTGPGAPSLSGSLGGASSTPSLLSTVVKTPPTGGAKRGRGRSDSMPPR 873
            |  ..|...:.||::..:||       ||:|...|:|      |.|...||||...|..| :|..
  Fly   716 K--SDDSAIENSPTTSTTTG-------GSVGHRHSSP------VSTKKKGGAKPQSGGKD-VPTE 764

  Fly   874 STTPSSVVAHSGRTKSPAASQPQL---QQQMKKRPTRVVPGTTTPRRVSDASMASESDSDSDEP- 934
            ....||    ||:. :|..:...|   |.|:.:..|                      .|:.|| 
  Fly   765 DKDASS----SGKL-NPLETLSLLSGMQFQVARNGT----------------------GDNGEPQ 802

  Fly   935 -----------------VRRPKRQSAKDKPQAGKAQPPGKGRLASSASSTAPAAHPSDDSEEDEE 982
                             ...|..||              :.|.:|...:.||..   ::.:::||
  Fly   803 LIVNLELNGVKYSGVLVANVPLSQS--------------ETRTSSPCHAEAPTV---EEEKDEEE 850

  Fly   983 EEEPSAARAASSKQQQQQASSLRGSRAGGNRAMSSGAASAKG 1024
            ||||.||...|.:...:|.:........|:..:.:|.|||.|
  Fly   851 EEEPKAAEEESHRSPVKQENEDVDQDMEGSEVLLNGGASAVG 892

Known Domains:


GeneSequenceDomainRegion External IDIdentity
htkNP_573330.3 RBB1NT 171..262 CDD:285392 6/21 (29%)
ARID 299..381 CDD:279697 29/98 (30%)
Tudor-knot 692..751 CDD:288553 15/74 (20%)
retnNP_788434.1 BRIGHT 294..386 CDD:128777 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2744
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1374
21.930

Return to query results.
Submit another query.